Comparing AO353_17845 FitnessBrowser__pseudo3_N2E3:AO353_17845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
33% identity, 89% coverage: 24:255/261 of query aligns to 1:228/229 of 5t0wA
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
31% identity, 89% coverage: 24:254/261 of query aligns to 2:231/237 of 5kkwA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
25% identity, 89% coverage: 26:256/261 of query aligns to 3:228/229 of 6svfA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
25% identity, 86% coverage: 32:256/261 of query aligns to 3:227/234 of 3k4uE
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
31% identity, 34% coverage: 26:114/261 of query aligns to 2:90/130 of 7a99B
Sites not aligning to the query:
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
21% identity, 86% coverage: 32:256/261 of query aligns to 3:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
22% identity, 86% coverage: 32:256/261 of query aligns to 3:226/226 of 4zv1A
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
25% identity, 87% coverage: 24:251/261 of query aligns to 2:231/240 of 4h5fA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
21% identity, 87% coverage: 34:259/261 of query aligns to 4:225/226 of 8eyzA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
23% identity, 85% coverage: 35:255/261 of query aligns to 28:253/260 of P02911
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
22% identity, 85% coverage: 33:255/261 of query aligns to 1:222/224 of 4ymxA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
23% identity, 85% coverage: 35:255/261 of query aligns to 6:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
23% identity, 85% coverage: 35:255/261 of query aligns to 6:231/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
23% identity, 85% coverage: 35:255/261 of query aligns to 6:231/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
23% identity, 85% coverage: 35:255/261 of query aligns to 6:231/238 of 1lafE
5lomB Crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution (see paper)
23% identity, 90% coverage: 25:259/261 of query aligns to 1:235/250 of 5lomB
5l9oB Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
23% identity, 89% coverage: 29:259/261 of query aligns to 7:234/243 of 5l9oB
5l9oA Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
23% identity, 89% coverage: 29:259/261 of query aligns to 6:233/241 of 5l9oA
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
23% identity, 85% coverage: 35:255/261 of query aligns to 3:228/235 of 5owfA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
23% identity, 85% coverage: 34:255/261 of query aligns to 27:253/260 of P0AEU0
Sites not aligning to the query:
>AO353_17845 FitnessBrowser__pseudo3_N2E3:AO353_17845
MKARLLLCSLLTFSVQAIAQNAPSHLDQVIERGHLKVCTTGDYKPYTYLRAEGGYEGIDI
AMAQSLAKSLNVDVQWVPTTWKNLMTDFLADRCDIGMGGISVSLERQKKAAFSDTLGVDG
KIPLVRCEDKQRYQTVEQLNQSSVRLIEPAGGTNEVFARTHLPNATLTLFPDNVTIFEQL
LENKADVMITDASEARYQQKLKPGLCAVNPEQYLQYSEKAYLLPRDDVAWKAYVDQWLHL
SKATGAYDAVLAQWLATAPGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory