Comparing AO353_19320 FitnessBrowser__pseudo3_N2E3:AO353_19320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3u9sF Crystal structure of p. Aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex (see paper)
46% identity, 100% coverage: 1:538/538 of query aligns to 3:537/537 of 3u9sF
8f3dA 3-methylcrotonyl-coa carboxylase in filament, beta-subunit centered (see paper)
45% identity, 86% coverage: 50:513/538 of query aligns to 85:555/566 of 8f3dA
1vrgA Crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
32% identity, 93% coverage: 21:521/538 of query aligns to 2:499/515 of 1vrgA
3n6rB Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
32% identity, 86% coverage: 50:510/538 of query aligns to 26:479/506 of 3n6rB
Q168G2 Propionyl-CoA carboxylase beta chain; EC 6.4.1.3 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
32% identity, 86% coverage: 50:510/538 of query aligns to 30:483/510 of Q168G2
1on3E Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
30% identity, 95% coverage: 22:530/538 of query aligns to 9:511/520 of 1on3E
8pn7A Engineered glycolyl-coa carboxylase (g20r variant) with bound coa (see paper)
29% identity, 89% coverage: 49:527/538 of query aligns to 25:496/506 of 8pn7A
Sites not aligning to the query:
1on3C Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
29% identity, 95% coverage: 22:530/538 of query aligns to 5:501/510 of 1on3C
7ybuP Human propionyl-coenzyme a carboxylase
29% identity, 89% coverage: 49:527/538 of query aligns to 28:497/507 of 7ybuP
3ib9A Propionyl-coa carboxylase beta subunit, d422l (see paper)
30% identity, 89% coverage: 30:510/538 of query aligns to 14:494/521 of 3ib9A
1xnyA Biotin and propionyl-coa bound to acyl-coa carboxylase beta subunit from s. Coelicolor (pccb) (see paper)
30% identity, 89% coverage: 30:510/538 of query aligns to 14:494/521 of 1xnyA
5iniF Structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics (see paper)
30% identity, 82% coverage: 30:470/538 of query aligns to 12:457/511 of 5iniF
8sgxE Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
28% identity, 89% coverage: 49:529/538 of query aligns to 10:478/489 of 8sgxE
4g2rB Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor haloxyfop from mycobacterium tuberculosis (see paper)
30% identity, 73% coverage: 64:455/538 of query aligns to 1:377/441 of 4g2rB
6tzvA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis
29% identity, 73% coverage: 63:454/538 of query aligns to 1:361/426 of 6tzvA
6prwA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p derivative from mycobacterium tuberculosis
29% identity, 73% coverage: 63:454/538 of query aligns to 1:361/426 of 6prwA
6pk2A Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p derivative from mycobacterium tuberculosis
29% identity, 73% coverage: 63:454/538 of query aligns to 1:361/426 of 6pk2A
6p7uA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p from mycobacterium tuberculosis
29% identity, 73% coverage: 63:454/538 of query aligns to 1:361/426 of 6p7uA
6tzvC Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis
28% identity, 73% coverage: 63:454/538 of query aligns to 1:357/410 of 6tzvC
6prwC Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p derivative from mycobacterium tuberculosis
28% identity, 73% coverage: 63:454/538 of query aligns to 1:357/410 of 6prwC
>AO353_19320 FitnessBrowser__pseudo3_N2E3:AO353_19320
MPQIESQLDIHSRQFAQNREAMLSNIEQFRQLERNLLAKAAEAKPKFDKRGQLLPRARLN
LLLDPGAPFLELASLAGYKLHDDKDGSQAGGGLIAGIGYVSGVRVLVVANNSAIKGGTIS
PSGLKKSLRLQQIAMENKLPVITLAESGGANLNYAAEIFVEGARSFANQARMSAMGLPQI
TVVHGSATAGGAYQPGLSDYVVVVRGKAKLFLAGPPLLKAATGEVATDEELGGAEMHAQI
AGTAEYLAENDADGVRLVREIVSLLPWNAQLPQRSAEHWDEPLYPIDDLLGLIPDDPKKP
YDVREIIARIADGSRFLEFKGEFDQQTMCGHLKIQGRPCGFIGNNGPITPQGASKAAQFI
QLCDQSQTPLLFFHNTTGFMVGTESEQQGVIKHGAKMIQAVANARVPKLTMVVGGSYGAG
NYAMCGRGLDPRFIFAWPNSRTAVMGGAQAGKVLRIVSEARQAKDGLVPDPKMLDTLEQV
TAQKLDSQSTALYGSANLWDDGLIDPRDTRTLLGYLLDICHEAEVRQLQPNSFGIARF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory