SitesBLAST
Comparing AO353_19655 FitnessBrowser__pseudo3_N2E3:AO353_19655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
41% identity, 96% coverage: 2:256/267 of query aligns to 12:264/275 of A0QV10
- K262 (≠ Q254) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
36% identity, 99% coverage: 1:265/267 of query aligns to 21:281/288 of 4gieA
- active site: D55 (= D34), Y60 (= Y39), K85 (= K64), H118 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G9), W31 (≠ F11), D55 (= D34), Y60 (= Y39), H118 (= H97), W119 (= W98), N148 (= N130), Q169 (= Q152), W195 (≠ Y178), S196 (≠ M179), P197 (≠ T180), L198 (= L181), S200 (≠ Y183), L207 (= L187), A224 (= A204), I239 (= I219), P240 (= P220), K241 (≠ S221), S242 (= S222), R247 (≠ N227), E250 (≠ S230), N251 (= N231)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
36% identity, 99% coverage: 1:265/267 of query aligns to 10:270/277 of 4fziA
7s5fB Crystal structure of mannose-6-phosphate reductase from celery (apium graveolens) leaves with NADP+ and mannonic acid bound (see paper)
34% identity, 97% coverage: 1:259/267 of query aligns to 9:299/309 of 7s5fB
- binding d-mannonic acid: W19 (≠ F11), D46 (≠ I38), Y47 (= Y39), W78 (= W66), H107 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G9), V18 (≠ T10), W19 (≠ F11), D42 (= D34), Y47 (= Y39), N161 (= N130), Q182 (= Q152), H208 (≠ Y178), T209 (≠ M179), P210 (≠ T180), L211 (= L181), G213 (vs. gap), A214 (vs. gap), A244 (= A204), I259 (= I219), K261 (≠ S221), S262 (= S222), S263 (≠ T223), R267 (≠ N227), E270 (≠ S230), N271 (= N231)
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
38% identity, 99% coverage: 1:265/267 of query aligns to 14:271/275 of 3d3fA
- active site: D48 (= D34), Y53 (= Y39), K78 (= K64), H111 (= H97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G9), F24 (= F11), D48 (= D34), Y53 (= Y39), H111 (= H97), S140 (= S129), N141 (= N130), Q162 (= Q152), W188 (≠ Y178), S189 (≠ M179), P190 (≠ T180), L191 (= L181), Q193 (≠ Y183), L197 (= L187), I229 (= I219), K231 (≠ S221), S232 (= S222), K234 (≠ Q224), R237 (≠ N227), E240 (≠ S230), N241 (= N231)
3wbwA Crystal structure of gox0644 in complex with NADPH
37% identity, 94% coverage: 2:252/267 of query aligns to 13:257/271 of 3wbwA
- active site: D45 (= D34), Y50 (= Y39), K71 (= K64), H104 (= H97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), H104 (= H97), N136 (= N130), W183 (≠ Y178), R184 (≠ M179), P185 (≠ T180), L186 (= L181), L192 (= L187), A209 (= A204), K226 (≠ S221), S227 (= S222), V228 (≠ T223), R232 (≠ N227), E235 (≠ S230), N236 (= N231)
1a80A Native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. Complexed with NADPH (see paper)
40% identity, 94% coverage: 2:253/267 of query aligns to 12:263/277 of 1a80A
- active site: D44 (= D34), Y49 (= Y39), K74 (= K64), H107 (= H97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G9), F21 (= F11), D44 (= D34), Y49 (= Y39), H107 (= H97), S138 (= S129), Q160 (= Q152), W186 (≠ Y178), G187 (≠ M179), P188 (≠ T180), L189 (= L181), Q191 (≠ Y183), A214 (= A204), F229 (≠ I219), K231 (≠ S221), S232 (= S222), V233 (≠ T223), R234 (≠ Q224), R237 (≠ N227), E240 (≠ S230), N241 (= N231)
P06632 2,5-diketo-D-gluconic acid reductase A; 2,5-DKG reductase A; 2,5-DKGR A; 25DKGR-A; AKR5C; EC 1.1.1.346 from Corynebacterium sp. (strain ATCC 31090) (see 3 papers)
40% identity, 94% coverage: 2:253/267 of query aligns to 13:264/278 of P06632
- Y50 (= Y39) active site, Proton donor
- H108 (= H97) binding
- 188:242 (vs. 179:231, 33% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1m9hA Corynebacterium 2,5-dkgr a and phe 22 replaced with tyr (f22y), lys 232 replaced with gly (k232g), arg 238 replaced with his (r238h)and ala 272 replaced with gly (a272g)in presence of nadh cofactor (see paper)
39% identity, 94% coverage: 2:253/267 of query aligns to 12:263/277 of 1m9hA
- active site: D44 (= D34), Y49 (= Y39), K74 (= K64), H107 (= H97)
- binding nicotinamide-adenine-dinucleotide: G19 (= G9), Y21 (≠ F11), Y49 (= Y39), H107 (= H97), Q160 (= Q152), W186 (≠ Y178), G187 (≠ M179), P188 (≠ T180), L189 (= L181), Q191 (≠ Y183), A214 (= A204), F229 (≠ I219), P230 (= P220), G231 (≠ S221), H237 (≠ N227), N241 (= N231)
2vdgA Barley aldose reductase 1 complex with butanol (see paper)
35% identity, 96% coverage: 2:256/267 of query aligns to 11:282/308 of 2vdgA
- active site: D43 (= D34), Y48 (= Y39), K76 (= K64), H109 (= H97)
- binding 1-butanol: E47 (≠ I38), E123 (= E102), A124 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G18 (= G9), T19 (= T10), W20 (≠ F11), D43 (= D34), Y48 (= Y39), K76 (= K64), H109 (= H97), C154 (≠ S129), N155 (= N130), Q176 (= Q152), Y202 (= Y178), S203 (≠ M179), P204 (≠ T180), L205 (= L181), S207 (≠ Y183), S208 (≠ G184), N211 (vs. gap), I245 (= I219), P246 (= P220), K247 (≠ S221), S248 (= S222), S249 (≠ T223), K250 (≠ Q224), R253 (≠ N227), E256 (≠ S230), N257 (= N231)
Sites not aligning to the query:
2bgsA Holo aldose reductase from barley (see paper)
35% identity, 96% coverage: 2:256/267 of query aligns to 11:282/308 of 2bgsA
- active site: D43 (= D34), Y48 (= Y39), K76 (= K64), H109 (= H97)
- binding bicarbonate ion: W20 (≠ F11), Y48 (= Y39), H109 (= H97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G18 (= G9), T19 (= T10), W20 (≠ F11), D43 (= D34), Y48 (= Y39), C154 (≠ S129), N155 (= N130), Q176 (= Q152), Y202 (= Y178), S203 (≠ M179), P204 (≠ T180), L205 (= L181), S207 (≠ Y183), I245 (= I219), P246 (= P220), K247 (≠ S221), S248 (= S222), K250 (≠ Q224), R253 (≠ N227), E256 (≠ S230), N257 (= N231)
Sites not aligning to the query:
Q0PGJ6 NADPH-dependent aldo-keto reductase, chloroplastic; AtChlAKR; Aldo-keto reductase family 4 member C9; EC 1.1.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 95% coverage: 4:257/267 of query aligns to 17:292/315 of Q0PGJ6
3h7uA Crystal structure of the plant stress-response enzyme akr4c9 (see paper)
33% identity, 95% coverage: 4:257/267 of query aligns to 14:289/312 of 3h7uA
- active site: S24 (≠ Q14), D44 (= D34), Y49 (= Y39), K78 (= K64), H111 (= H97)
- binding acetate ion: W21 (≠ F11), Y49 (= Y39), H111 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G9), T20 (= T10), W21 (≠ F11), D44 (= D34), Y49 (= Y39), H111 (= H97), W112 (= W98), N156 (= N130), Q177 (= Q152), Y203 (= Y178), S204 (≠ M179), P205 (≠ T180), L206 (= L181), S208 (vs. gap), P209 (vs. gap), G210 (vs. gap), A236 (= A204), L251 (≠ I219), P252 (= P220), K253 (≠ S221), S254 (= S222), R259 (≠ N227), E262 (≠ S230), N263 (= N231)
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
33% identity, 95% coverage: 3:255/267 of query aligns to 15:264/276 of Q9GV41
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
33% identity, 95% coverage: 3:255/267 of query aligns to 20:269/281 of 1vbjA
- active site: D52 (= D34), Y57 (= Y39), K82 (= K64), H115 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G26 (= G9), M27 (≠ T10), W28 (≠ F11), D52 (= D34), Y57 (= Y39), H115 (= H97), N145 (= N130), Q166 (= Q152), W192 (≠ Y178), S193 (≠ M179), P194 (≠ T180), L195 (= L181), Q197 (≠ Y183), G198 (= G184), V201 (≠ L187), A218 (= A204), I233 (= I219), K235 (≠ S221), S236 (= S222), G237 (≠ T223), R241 (≠ N227), E244 (≠ S230), N245 (= N231)
1vp5A Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
36% identity, 95% coverage: 1:254/267 of query aligns to 11:265/284 of 1vp5A
- active site: D44 (= D34), Y49 (= Y39), K78 (= K64), H111 (= H97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G9), V20 (≠ T10), F21 (= F11), D44 (= D34), Y49 (= Y39), N140 (= N130), Q161 (= Q152), W187 (≠ Y178), G188 (≠ M179), P189 (≠ T180), F190 (≠ L181), E192 (≠ Y183), F198 (≠ L187), A215 (= A204), I230 (= I219), K232 (≠ S221), T233 (≠ S222), V234 (≠ T223), R238 (≠ N227), E241 (≠ S230), N242 (= N231)
3b3dA B.Subtilis ytbe (see paper)
37% identity, 99% coverage: 1:265/267 of query aligns to 15:276/280 of 3b3dA
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
38% identity, 96% coverage: 2:256/267 of query aligns to 12:264/274 of 2wzmA
- active site: D44 (= D34), Y49 (= Y39), K74 (= K64), H107 (= H97)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (= Y178), G187 (≠ M179), P188 (≠ T180), L189 (= L181), G190 (≠ A182), V191 (≠ Y183), G192 (= G184), L195 (= L187), A212 (= A204), I227 (= I219), R229 (≠ S221), S230 (= S222), R235 (≠ N227), N239 (= N231)
Sites not aligning to the query:
A0QV09 Aldo-keto reductase MSMEG_2407/MSMEI_2346; AKR; AKR5H1; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
38% identity, 96% coverage: 2:256/267 of query aligns to 21:273/283 of A0QV09
- G196 (≠ M179) binding
- L198 (= L181) binding
- V200 (≠ Y183) binding
- I236 (= I219) binding
- R238 (≠ S221) binding
- S239 (= S222) binding
- A240 (≠ T223) binding
- R244 (≠ N227) binding
- S247 (= S230) binding
- N248 (= N231) binding
Sites not aligning to the query:
5jh2A Crystal structure of the holo form of akr4c7 from maize (see paper)
37% identity, 90% coverage: 3:241/267 of query aligns to 12:245/257 of 5jh2A
- active site: D43 (= D34), Y48 (= Y39), K77 (= K64), H110 (= H97)
- binding adenosine-2'-5'-diphosphate: S185 (≠ M179), P186 (≠ T180), L187 (= L181), G188 (= G184), A208 (= A204), K225 (≠ S221), S226 (= S222), T227 (= T223), R231 (≠ N227), N235 (= N231)
Query Sequence
>AO353_19655 FitnessBrowser__pseudo3_N2E3:AO353_19655
MSVPAFGLGTFRLQGQVVIDSVSTGLELGYRAIDTAQIYDNEADVGQAIAASGIAREELF
ITSKIWIANFAKDQLIASLKDSLRKLQTDYLDLTLIHWPSPENQVPVHEFMGALLEAKAL
GLTRQIGVSNFTVDLMQQAIDAVGADNIATNQIELHPYLQNRTVVEFAQSQGIQITSYMT
LAYGEVLKDPVIQQIAERHQATPAQVTLAWAMQQGYAVIPSSTQRANLDSNLAARELTLS
EADMTLIAGLERGQRLTSPKGIAPDWD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory