SitesBLAST
Comparing AO353_20335 FitnessBrowser__pseudo3_N2E3:AO353_20335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WPQ3 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit; EC 6.3.4.14 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 97% coverage: 5:631/649 of query aligns to 1:636/654 of P9WPQ3
- K322 (≠ P324) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7ybuA Human propionyl-coenzyme a carboxylase
43% identity, 99% coverage: 9:649/649 of query aligns to 8:670/670 of 7ybuA
P05165 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Homo sapiens (Human) (see 6 papers)
43% identity, 99% coverage: 9:649/649 of query aligns to 66:728/728 of P05165
- A75 (= A18) to P: in PA-1; dbSNP:rs794727479
- R77 (= R20) to W: in PA-1; loss of function; dbSNP:rs141371306
- A138 (= A81) to T: in PA-1; loss of function; dbSNP:rs202247814
- I164 (≠ L107) to T: in PA-1; loss of function; dbSNP:rs202247815
- G197 (= G140) to E: in PA-1
- M229 (= M172) to K: in PA-1; dbSNP:rs375628794
- Q297 (= Q240) to R: in PA-1
- D368 (= D311) to G: in PA-1
- M373 (≠ Q316) to K: in PA-1; unstable protein; loss of function; dbSNP:rs121964958
- G379 (= G322) to V: in PA-1; dbSNP:rs794727087
- C398 (≠ V341) to R: in PA-1
- R399 (= R342) to Q: in PA-1; dbSNP:rs1301904623
- P423 (≠ S365) to L: in PA-1; dbSNP:rs1443858896
- L532 (= L460) natural variant: Missing (in PA-1)
- V551 (= V480) to F: in dbSNP:rs61749895
- W559 (= W489) to L: in PA-1; dbSNP:rs118169528
- G631 (= G559) to R: in PA-1; loss of function; dbSNP:rs796052018
- G668 (= G589) to R: in PA-1; loss of biotinylation; dbSNP:rs771438170
- K694 (= K615) modified: N6-biotinyllysine; by HLCS
- C712 (= C633) natural variant: Missing (in PA-1; loss of biotinylation)
Sites not aligning to the query:
- 1:52 modified: transit peptide, Mitochondrion
Q5LUF3 Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
42% identity, 99% coverage: 5:649/649 of query aligns to 1:681/681 of Q5LUF3
- F348 (= F352) binding
- W515 (= W489) mutation to L: No effect on holoenzyme formation.
- L599 (≠ T552) mutation to A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- L602 (= L555) mutation to A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- M603 (≠ Q556) mutation to A: No effect on holoenzyme formation. Loss of holoenzyme formation; when associated with A-602 and A-603.
- K647 (= K615) modified: N6-biotinyllysine
8sgxX Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
40% identity, 99% coverage: 9:649/649 of query aligns to 1:657/657 of 8sgxX
3n6rG Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
41% identity, 99% coverage: 6:649/649 of query aligns to 1:646/646 of 3n6rG
- active site: K115 (= K120), K157 (= K162), D180 (≠ S199), H193 (= H212), R219 (= R238), T258 (= T277), E260 (= E279), E273 (= E292), N275 (= N294), R277 (= R296), E281 (= E300), R323 (= R342), G519 (≠ N525)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: M611 (= M614), K612 (= K615)
2vr1A Crystal structure of biotin carboxylase from e. Coli in complex with atp analog, adpcf2p. (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:428/444 of 2vr1A
- active site: K116 (= K120), K159 (= K162), D194 (≠ S199), H207 (= H212), R233 (= R238), T272 (= T277), E274 (= E279), E286 (= E292), N288 (= N294), R290 (= R296), E294 (= E300), R336 (= R342)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: K159 (= K162), R165 (≠ K170), M167 (= M172), Y201 (= Y206), L202 (= L207), E274 (= E279), L276 (= L281), E286 (= E292), N288 (= N294)
Sites not aligning to the query:
3rupA Crystal structure of e.Coli biotin carboxylase in complex with two adp and two ca ions (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/444 of 3rupA
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding adenosine-5'-diphosphate: Y82 (= Y86), G83 (= G87), K116 (= K120), K159 (= K162), G164 (= G167), G164 (= G167), G165 (= G168), G166 (= G169), R167 (≠ K170), M169 (= M172), F193 (= F196), E201 (= E204), K202 (= K205), Y203 (= Y206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), K238 (= K241), L278 (= L281), E288 (= E292), R292 (= R296), V295 (= V299), E296 (= E300), R338 (= R342), D382 (= D388)
- binding calcium ion: E87 (= E91), E276 (= E279), E288 (= E292), E288 (= E292), N290 (= N294)
Sites not aligning to the query:
3g8cA Crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/444 of 3g8cA
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding adenosine-5'-diphosphate: I157 (≠ L160), K159 (= K162), G164 (= G167), M169 (= M172), E201 (= E204), K202 (= K205), Y203 (= Y206), L204 (= L207), Q233 (= Q236), H236 (= H239), L278 (= L281), E288 (= E292)
- binding bicarbonate ion: K238 (= K241), R292 (= R296), Q294 (= Q298), V295 (= V299), E296 (= E300)
- binding biotin: Y82 (= Y86), F84 (= F88), R292 (= R296), V295 (= V299), R338 (= R342), D382 (= D388)
- binding magnesium ion: E276 (= E279), E288 (= E292)
Sites not aligning to the query:
P24182 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Escherichia coli (strain K12) (see 3 papers)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/449 of P24182
- R19 (= R23) mutation to E: Loss of homodimerization. No effect on ATP binding.
- E23 (≠ A27) mutation to R: Loss of homodimerization. No effect on ATP binding.
- K116 (= K120) binding
- K159 (= K162) binding
- GG 165:166 (= GG 168:169) binding
- EKYL 201:204 (= EKYL 204:207) binding
- H209 (= H212) binding
- H236 (= H239) binding
- K238 (= K241) binding
- E276 (= E279) binding ; binding
- E288 (= E292) binding ; binding
- R292 (= R296) active site; binding
- V295 (= V299) binding
- E296 (= E300) mutation to A: Severe reduction in catalytic activity.
- R338 (= R342) binding ; binding ; mutation to A: Severe reduction in catalytic activity.
- F363 (≠ P369) mutation to A: Loss of homodimerization. No effect on ATP binding.
- R366 (= R372) mutation to E: Loss of homodimerization. No effect on ATP binding.
3jziA Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazole series (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/445 of 3jziA
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding 7-amino-2-[(2-chlorobenzyl)amino]-1-{[(1S,2S)-2-hydroxycycloheptyl]methyl}-1H-benzimidazole-5-carboxamide: K116 (= K120), K159 (= K162), A160 (= A163), G164 (= G167), G165 (= G168), M169 (= M172), Y199 (≠ L202), E201 (= E204), K202 (= K205), Y203 (= Y206), H209 (= H212), Q233 (= Q236), H236 (= H239), L278 (= L281), I287 (≠ M291), E288 (= E292)
2w6oA Crystal structure of biotin carboxylase from e. Coli in complex with 4-amino-7,7-dimethyl-7,8-dihydro-quinazolinone fragment (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/445 of 2w6oA
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding 4-amino-7,7-dimethyl-7,8-dihydroquinazolin-5(6H)-one: K159 (= K162), K202 (= K205), Y203 (= Y206), L204 (= L207), L278 (= L281)
Sites not aligning to the query:
2w6nA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/445 of 2w6nA
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding 2-amino-n,n-bis(phenylmethyl)-1,3-oxazole-5-carboxamide: I157 (≠ L160), K159 (= K162), M169 (= M172), E201 (= E204), K202 (= K205), Y203 (= Y206), L278 (= L281)
2v59A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 2 (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/445 of 2v59A
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding 6-(2,6-dimethoxyphenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: K159 (= K162), Y203 (= Y206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), L278 (= L281)
Sites not aligning to the query:
8hz4A The tetrameric structure of biotin carboxylase from chloroflexus aurantiacus in complex with bicarbonate
52% identity, 69% coverage: 5:451/649 of query aligns to 1:442/456 of 8hz4A
6oi9A Crystal structure of e. Coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/446 of 6oi9A
- active site: E276 (= E279), E288 (= E292), N290 (= N294), E296 (= E300), R338 (= R342)
- binding 7-[(3S)-3-(aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3-d]pyrimidin-2-amine: K159 (= K162), M169 (= M172), E201 (= E204), Y203 (= Y206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), E276 (= E279), L278 (= L281), E288 (= E292)
Sites not aligning to the query:
2w71A Crystal structure of biotin carboxylase from e. Coli in complex with the imidazole-pyrimidine inhibitor (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/446 of 2w71A
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding 4-[1-(2,6-dichlorobenzyl)-2-methyl-1H-imidazol-4-yl]pyrimidin-2-amine: K159 (= K162), Y203 (= Y206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), L278 (= L281)
Sites not aligning to the query:
2w70A Crystal structure of biotin carboxylase from e. Coli in complex with the amino-thiazole-pyrimidine fragment (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/446 of 2w70A
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding 4-(2-amino-1,3-thiazol-4-yl)pyrimidin-2-amine: I157 (≠ L160), K159 (= K162), G166 (= G169), M169 (= M172), E201 (= E204), Y203 (= Y206), L204 (= L207), L278 (= L281)
2w6zA Crystal structure of biotin carboxylase from e. Coli in complex with the 3-(3-methyl-but-2-enyl)-3h-purin-6-ylamine fragment (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/446 of 2w6zA
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding 3-(3-methylbut-2-en-1-yl)-3H-purin-6-amine: K159 (= K162), Y203 (= Y206), L204 (= L207), L278 (= L281)
2w6qA Crystal structure of biotin carboxylase from e. Coli in complex with the triazine-2,4-diamine fragment (see paper)
51% identity, 67% coverage: 5:436/649 of query aligns to 1:430/446 of 2w6qA
- active site: K116 (= K120), K159 (= K162), D196 (≠ S199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E292), N290 (= N294), R292 (= R296), E296 (= E300), R338 (= R342)
- binding 6-(2-phenoxyethoxy)-1,3,5-triazine-2,4-diamine: I157 (≠ L160), K159 (= K162), E201 (= E204), K202 (= K205), Y203 (= Y206), L204 (= L207), H236 (= H239), L278 (= L281)
Query Sequence
>AO353_20335 FitnessBrowser__pseudo3_N2E3:AO353_20335
MSAPVLTTLLVANRGEIACRVMRTAKALGLTTVAVHSATDRDARHSREADIRVDLGGSKA
ADSYLQIDKLLAAAKASGAQAIHPGYGFLSENAGFARAIEAAGLIFLGPPASAIDAMGSK
SAAKALMETAGVPLVPGYHGEAQDLETFRDAAERIGYPVLLKATAGGGGKGMKVVEDVSQ
LAEALASAQREAQSSFGDSRMLVEKYLLKPRHVEIQVFADQHGNCLYLNERDCSIQRRHQ
KVVEEAPAPGLSAQLRKAMGEAAVRAAQAIGYVGAGTVEFLLDSRGEFFFMEMNTRLQVE
HPVTEAITGLDLVAWQIRVAQGEPLPMTQAQVPLLGHAIEVRLYAEDPSNDFLPATGHLA
LYRESAAGPGRRVDSGVEEGDSISPFYDPMLGKLIAWGVDREQARLRLLSMLEEFAIGGL
KTNINFLRRIIGHPAFAAAELDTGFIPRYQDQLLPAPNELSDAFWQAAAQAFAQSQAHHV
RADDPGSPWAVGSGFRAGLPAETTLHLSCEDQDRAITLATAETRNTELNGEQLLVEHHGL
RRQHRAIRQAETLYLQWEGELRCIKLYDPIAAVEASHSHQGGLTAPMNGSIVRVLVTPGQ
TVETGAQLVVLEAMKMEHSIRAPHAGVVKALYCQEGEMVNEGSALVELE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory