Comparing AO353_20455 FitnessBrowser__pseudo3_N2E3:AO353_20455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
2b0cA The crystal structure of the putative phosphatase from escherichia coli
22% identity, 82% coverage: 14:191/217 of query aligns to 6:184/199 of 2b0cA
P0A8Y3 Alpha-D-glucose 1-phosphate phosphatase YihX; Alpha-D-glucose-1-P phosphatase; Alpha-D-glucose-1-phosphatase; Haloacid dehalogenase-like phosphatase 4; HAD4; EC 3.1.3.10 from Escherichia coli (strain K12)
22% identity, 82% coverage: 14:191/217 of query aligns to 4:182/199 of P0A8Y3
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
23% identity, 56% coverage: 73:193/217 of query aligns to 81:195/231 of Q51645
Sites not aligning to the query:
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
23% identity, 56% coverage: 73:194/217 of query aligns to 81:196/226 of 2no5B
Sites not aligning to the query:
6z1kA A de novo enzyme for the morita-baylis-hillman reaction bh32.6 (see paper)
25% identity, 53% coverage: 87:200/217 of query aligns to 93:206/231 of 6z1kA
Sites not aligning to the query:
>AO353_20455 FitnessBrowser__pseudo3_N2E3:AO353_20455
MNTLNRPATINTVVFDLGNVLIRWNPRNLYRKIFGEDVQAMETFLSEVCPPEWNERQDAG
RSWQEGVEEAIARHPSQEALIRAYHERWEETLGGVLEESVQILDELHAKGVRLLALTNWS
AETFPIALQRFPFLQTFEGILVSGEEGLIKPDPAIFQLLKSRYRFEGHHAVFIDDHAPNI
AGARQEGFNALQFTSAAQLRKDLAALGLPVLVQNEPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory