SitesBLAST
Comparing AO353_20540 FitnessBrowser__pseudo3_N2E3:AO353_20540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3fslA Crystal structure of tyrosine aminotransferase tripple mutant (p181q, r183g,a321k) from escherichia coli at 2.35 a resolution
52% identity, 99% coverage: 3:398/398 of query aligns to 1:397/397 of 3fslA
- active site: W131 (= W132), D212 (= D213), A214 (= A215), K247 (= K248)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G103 (= G104), G104 (= G105), S105 (≠ T106), W131 (= W132), N184 (= N185), D212 (= D213), A214 (= A215), Y215 (= Y216), S244 (= S245), S246 (= S247), K247 (= K248), R255 (= R256)
3tatA Tyrosine aminotransferase from e. Coli (see paper)
52% identity, 99% coverage: 3:398/398 of query aligns to 1:397/397 of 3tatA
- active site: W131 (= W132), D212 (= D213), A214 (= A215), K247 (= K248)
- binding pyridoxal-5'-phosphate: G103 (= G104), G104 (= G105), S105 (≠ T106), H179 (= H180), N184 (= N185), A214 (= A215), S246 (= S247), K247 (= K248), R255 (= R256)
5vwrA E.Coli aspartate aminotransferase-(1r,3s,4s)-3-amino-4- fluorocyclopentane-1-carboxylic acid (fcp)-alpha-ketoglutarate (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 5vwrA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-glutamic acid: I13 (= I15), G34 (= G36), G102 (= G104), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256), R374 (= R376)
5t4lA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 5t4lA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding (4R)-4-amino-6-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}hexanoic acid: G102 (= G104), G103 (= G105), T104 (= T106), W130 (= W132), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256)
3qpgA Crystal structures of escherichia coli aspartate aminotransferase reconstituted with 1-deaza-pyridoxal 5'-phosphate: internal aldimine and stable l-aspartate external aldimine (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 3qpgA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding (E)-N-{2-hydroxy-3-methyl-6-[(phosphonooxy)methyl]benzylidene}-L-aspartic acid: I13 (= I15), G34 (= G36), G102 (= G104), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256), R374 (= R376)
3pa9A Mechanism of inactivation of e. Coli aspartate aminotransferase by (s)-4-amino-4,5-dihydro-2-furancarboxylic acid (s-adfa) ph 7.5 (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 3pa9A
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding 4-aminofuran-2-carboxylic acid: G34 (= G36), W130 (= W132), K246 (= K248), F348 (= F350), R374 (= R376)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G103 (= G105), T104 (= T106), W130 (= W132), D211 (= D213), A213 (= A215), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256)
1x2aA Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-d- glutamic acid (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1x2aA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: I33 (≠ V35), G34 (= G36), Y65 (= Y67), G102 (= G104), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256), R280 (= R282), F348 (= F350), R374 (= R376)
1x29A Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-2- methyl-l-glutamic acid (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1x29A
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-2-methyl-l-glutamic acid: I13 (= I15), G34 (= G36), Y65 (= Y67), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256), R280 (= R282), F348 (= F350), R374 (= R376)
1x28A Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-l- glutamic acid (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1x28A
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I13 (= I15), Y65 (= Y67), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256), R280 (= R282), F348 (= F350), R374 (= R376)
1cq8A Aspartate aminotransferase (E.C. 2.6.1.1) complexed with c6-pyridoxal- 5p-phosphate (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1cq8A
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: I33 (≠ V35), G34 (= G36), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), A213 (= A215), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256), R374 (= R376)
1cq7A Aspartate aminotransferase (E.C. 2.6.1.1) complexed with c5-pyridoxal- 5p-phosphate (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1cq7A
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: I13 (= I15), I33 (≠ V35), G34 (= G36), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256), R374 (= R376)
1cq6A Aspartate aminotransferase complex with c4-pyridoxal-5p-phosphate (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1cq6A
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding 2-[o-phosphonopyridoxyl]-amino- butyric acid: G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), R254 (= R256)
1c9cA Aspartate aminotransferase complexed with c3-pyridoxal-5'-phosphate (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1c9cA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding alanyl-pyridoxal-5'-phosphate: G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), A213 (= A215), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256)
1aslA Crystal structures of escherichia coli aspartate aminotransferase in two conformations: comparison of an unliganded open and two liganded closed forms (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1aslA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-2-methyl-succinic acid: I13 (= I15), G34 (= G36), Y65 (= Y67), G102 (= G104), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), K246 (= K248), R254 (= R256), R280 (= R282), R374 (= R376)
1aseA The structure of wild type e. Coli aspartate aminotransferase reconstituted with plp-n-oxide
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1aseA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding pyridoxal-5'-phosphate-n-oxide: G102 (= G104), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), A213 (= A215), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256)
1asdA The structure of wild type e. Coli aspartate aminotransferase reconstituted with n-meplp
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1asdA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding n-methyl-pyridoxal-5'-phosphate: G102 (= G104), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), A213 (= A215), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256)
1artA X-ray crystallographic study of pyridoxal 5'-phosphate-type aspartate aminotransferases from escherichia coli in open and closed form (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1artA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding 2-methyl-L-aspartic acid: I33 (≠ V35), G34 (= G36), W130 (= W132), Y214 (= Y216), R374 (= R376)
- binding pyridoxal-5'-phosphate: G102 (= G104), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256)
1argA Aspartate aminotransferase, phospho-5'-pyridoxyl aspartate complex (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1argA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethylene)-amino]-succinic acid: I13 (= I15), G34 (= G36), Y65 (= Y67), G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), K246 (= K248), R254 (= R256), R280 (= R282), R374 (= R376)
1amsA X-ray crystallographic study of pyridoxamine 5'-phosphate-type aspartate aminotransferases from escherichia coli in three forms (see paper)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of 1amsA
- active site: W130 (= W132), D211 (= D213), A213 (= A215), K246 (= K248)
- binding glutaric acid: W130 (= W132), R374 (= R376)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G103 (= G105), T104 (= T106), W130 (= W132), N183 (= N185), D211 (= D213), Y214 (= Y216), S243 (= S245), S245 (= S247), R254 (= R256)
P00509 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Escherichia coli (strain K12) (see 7 papers)
46% identity, 99% coverage: 3:398/398 of query aligns to 1:396/396 of P00509
- Y65 (= Y67) mutation Y->F,S: Slight changes in activity.
- H133 (= H135) mutation to A: Slight increase in maximum velocity of the overall transamination reaction between aspartate and 2-oxoglutarate.; mutation to N: Decreases to 60% in maximum rate of the overall reactions in both directions.
- K246 (= K248) modified: N6-(pyridoxal phosphate)lysine
- R280 (= R282) mutation to V: Reduces first-order rate constant over 25000-fold.
- R374 (= R376) mutation to A: Reduces first-order rate constant about 10000-fold.; mutation R->F,Y: Second-order rate constants are reduced by >5 orders of magnitude.
Query Sequence
>AO353_20540 FitnessBrowser__pseudo3_N2E3:AO353_20540
MSLFSAVEMAPRDPILGLNEAFNADTRTNKVNLGVGVYCNEEGRIPLLRAVVEAETIRAA
QHASRGYLPIDGIAAYDQAVQKLLFGKDSPLLAAGRVVTAQSVGGTGALKIGADFLKQLL
PNAVVAISDPSWENHRALFETAGFPVQNYRYYDAATHDVNRAGLLEDLNALPNGSIVVLH
ACCHNPTGVDLSPADWNNVLDVIKAKNHVPFLDMAYQGFGDGIDEDAAAVRLFAESGLNF
FVSSSFSKSFSLYGERVGALSIVSESKEESARVLSQVKRVIRTNYSNPPTHGAAIVAAVL
NSPELRAQWEQELAEMRLRIRGMRQQMVDLLAKNAPHQDFSFVGRQRGMFSYSGLTVEQV
TRLRNEFGIYALDTGRICVATLNQSNIDVVTKAIAQVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory