SitesBLAST
Comparing AO353_20560 FitnessBrowser__pseudo3_N2E3:AO353_20560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
82% identity, 100% coverage: 1:492/493 of query aligns to 1:487/488 of 8vc5A
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
46% identity, 95% coverage: 4:471/493 of query aligns to 2:467/468 of 2cv2A
- active site: K246 (= K254)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R7), A7 (= A9), S9 (= S11), G17 (= G19), I21 (= I23), E41 (= E43), Y187 (= Y195), R205 (= R213), A206 (≠ G214), E208 (= E216), W209 (= W217), L235 (= L243), L236 (= L244)
- binding : S9 (= S11), T43 (= T45), D44 (= D46), R47 (= R49), V145 (= V153), R163 (= R171), Y168 (≠ I176), E172 (≠ R180), V177 (= V185), K180 (= K188), S181 (≠ T189), Y187 (= Y195), E207 (= E215), E208 (= E216), W209 (= W217), V211 (≠ P219), R237 (= R245), K241 (= K249), L272 (≠ R280), M273 (= M281), G274 (= G282), E282 (= E290), S299 (= S307), P303 (= P311), V304 (≠ I312), K309 (= K317), W312 (= W320), R319 (= R327), P357 (≠ G357), R358 (= R358), R417 (≠ Q421), Q432 (≠ P436), R435 (≠ F439), L442 (≠ A446), E443 (≠ S447), T444 (≠ S448), G446 (≠ S450), L447 (≠ V451), F448 (≠ L452)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
46% identity, 95% coverage: 4:471/493 of query aligns to 2:467/468 of 2cv1A
- active site: K246 (= K254)
- binding adenosine-5'-triphosphate: P8 (= P10), S9 (= S11), G17 (= G19), T18 (= T20), I21 (= I23), R47 (= R49), A206 (≠ G214), W209 (= W217), L235 (= L243), L236 (= L244)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R7), A7 (= A9), E41 (= E43), Y187 (= Y195), R205 (= R213), W209 (= W217)
- binding : S9 (= S11), E41 (= E43), T43 (= T45), D44 (= D46), R47 (= R49), V145 (= V153), R163 (= R171), V166 (= V174), E172 (≠ R180), V177 (= V185), K180 (= K188), S181 (≠ T189), Y187 (= Y195), E207 (= E215), E208 (= E216), W209 (= W217), V211 (≠ P219), R237 (= R245), K241 (= K249), K243 (= K251), M273 (= M281), G274 (= G282), S276 (= S284), E282 (= E290), S299 (= S307), P303 (= P311), V304 (≠ I312), K309 (= K317), W312 (= W320), R319 (= R327), P357 (≠ G357), R358 (= R358), R417 (≠ Q421), L427 (= L431), Q432 (≠ P436), R435 (≠ F439), L442 (≠ A446), E443 (≠ S447), T444 (≠ S448), G446 (≠ S450), L447 (≠ V451), F448 (≠ L452)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
46% identity, 95% coverage: 4:471/493 of query aligns to 2:467/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
46% identity, 95% coverage: 4:471/493 of query aligns to 2:467/468 of 1n78A
- active site: K246 (= K254)
- binding glutamol-amp: R5 (= R7), A7 (= A9), P8 (= P10), S9 (= S11), G17 (= G19), T18 (= T20), I21 (= I23), E41 (= E43), Y187 (= Y195), N191 (= N199), R205 (= R213), A206 (≠ G214), E208 (= E216), W209 (= W217), L235 (= L243), L236 (= L244)
- binding : S9 (= S11), T43 (= T45), D44 (= D46), R47 (= R49), V145 (= V153), R163 (= R171), V166 (= V174), Y168 (≠ I176), E172 (≠ R180), V177 (= V185), K180 (= K188), S181 (≠ T189), Y187 (= Y195), E207 (= E215), E208 (= E216), W209 (= W217), L210 (= L218), V211 (≠ P219), R237 (= R245), K241 (= K249), M273 (= M281), G274 (= G282), E282 (= E290), R297 (= R305), P303 (= P311), V304 (≠ I312), K309 (= K317), W312 (= W320), R319 (= R327), P357 (≠ G357), R358 (= R358), R417 (≠ Q421), L427 (= L431), Q432 (≠ P436), R435 (≠ F439), L442 (≠ A446), E443 (≠ S447), T444 (≠ S448), G446 (≠ S450), L447 (≠ V451), F448 (≠ L452)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
46% identity, 95% coverage: 4:471/493 of query aligns to 2:467/468 of 1j09A
- active site: K246 (= K254)
- binding adenosine-5'-triphosphate: H15 (= H17), E208 (= E216), L235 (= L243), L236 (= L244), K243 (= K251), I244 (≠ L252), S245 (= S253), K246 (= K254), R247 (= R255)
- binding glutamic acid: R5 (= R7), A7 (= A9), S9 (= S11), E41 (= E43), Y187 (= Y195), N191 (= N199), R205 (= R213), W209 (= W217)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
46% identity, 95% coverage: 4:471/493 of query aligns to 2:467/468 of P27000
- R358 (= R358) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
45% identity, 95% coverage: 4:471/493 of query aligns to 2:467/468 of 1g59A
- binding : D44 (= D46), R45 (≠ Q47), A46 (≠ L48), R47 (= R49), P109 (≠ S111), V145 (= V153), R163 (= R171), V166 (= V174), E172 (≠ R180), V177 (= V185), K180 (= K188), S181 (≠ T189), D182 (= D190), E207 (= E215), E208 (= E216), R237 (= R245), K241 (= K249), T242 (≠ S250), K243 (= K251), M273 (= M281), G274 (= G282), E282 (= E290), S299 (= S307), L300 (= L308), P303 (= P311), V304 (≠ I312), K309 (= K317), W312 (= W320), R319 (= R327), P357 (≠ G357), R358 (= R358), R417 (≠ Q421), K426 (= K430), L427 (= L431), Q432 (≠ P436), R435 (≠ F439), L442 (≠ A446), E443 (≠ S447), T444 (≠ S448), P445 (≠ V449), G446 (≠ S450), L447 (≠ V451), F448 (≠ L452)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
36% identity, 96% coverage: 3:474/493 of query aligns to 1:482/485 of 4griB
- active site: S9 (= S11), K253 (= K254)
- binding glutamic acid: R5 (= R7), A7 (= A9), S9 (= S11), E41 (= E43), Y194 (= Y195), R212 (= R213), W216 (= W217)
- binding zinc ion: C105 (= C107), C107 (= C109), Y128 (= Y130), C132 (≠ A134)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
38% identity, 96% coverage: 4:474/493 of query aligns to 3:501/502 of 6brlA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
35% identity, 96% coverage: 4:474/493 of query aligns to 103:562/564 of 3al0C
- active site: S110 (= S11), K335 (= K254)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R7), A108 (= A9), P109 (= P10), G118 (= G19), T122 (≠ I23), E142 (= E43), Y276 (= Y195), R294 (= R213), G295 (= G214), D297 (≠ E216), H298 (≠ W217), L324 (= L243), I325 (≠ L244), L333 (= L252)
- binding : T144 (= T45), D145 (= D46), R148 (= R49), Y208 (≠ S111), P213 (≠ Q116), K252 (≠ R171), M255 (≠ V174), I266 (≠ V185), K269 (= K188), S270 (≠ T189), Y276 (= Y195), D297 (≠ E216), H298 (≠ W217), L299 (= L218), S300 (≠ P219), N301 (≠ S220), K304 (= K223), R330 (≠ K249), P332 (≠ K251), G363 (= G282), W364 (= W283), R365 (≠ S284), E370 (= E290), S387 (= S307), K389 (≠ G309), V391 (≠ P311), I392 (= I312), K397 (= K317), W400 (= W320), R407 (= R327), E446 (≠ G357), K447 (≠ R358), Q453 (= Q364), I457 (≠ L368), R509 (≠ Q421), K520 (≠ R432), Q524 (≠ P436), R527 (≠ F439), V535 (≠ S447), T536 (≠ S448), G538 (≠ S450), L539 (≠ V451)
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
36% identity, 98% coverage: 4:484/493 of query aligns to 3:471/471 of P04805
- C98 (= C107) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C109) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ A134) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ E141) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ A143) mutation to Q: No change in activity or in zinc content.
- H131 (≠ R145) mutation to Q: No change in activity or in zinc content.
- H132 (≠ L146) mutation to Q: No change in activity or in zinc content.
- C138 (≠ H152) mutation to S: No change in activity or in zinc content.
- S239 (= S253) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
36% identity, 96% coverage: 4:475/493 of query aligns to 3:465/468 of 8i9iA
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
36% identity, 92% coverage: 3:458/493 of query aligns to 1:463/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
36% identity, 92% coverage: 3:458/493 of query aligns to 2:464/485 of Q8DLI5
- R6 (= R7) binding
- Y192 (= Y195) binding
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
36% identity, 66% coverage: 4:328/493 of query aligns to 3:298/380 of 4g6zA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 51% coverage: 7:257/493 of query aligns to 19:244/308 of P27305
- E55 (= E43) binding
- Y182 (= Y195) binding
- R200 (= R213) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
34% identity, 51% coverage: 7:255/493 of query aligns to 7:230/290 of 4a91A
- active site: S11 (= S11), K229 (= K254)
- binding glutamic acid: R7 (= R7), A9 (= A9), S11 (= S11), E43 (= E43), Y170 (= Y195), R188 (= R213), L192 (≠ W217)
- binding zinc ion: C99 (= C107), C101 (= C109), Y113 (= Y130), C117 (vs. gap)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
29% identity, 57% coverage: 7:287/493 of query aligns to 14:283/455 of 3aiiA
7waoA Glutamyl-tRNA synthetase from plasmodium falciparum (pfers) in complex with mn (see paper)
26% identity, 44% coverage: 3:217/493 of query aligns to 9:212/502 of 7waoA
Sites not aligning to the query:
Query Sequence
>AO353_20560 FitnessBrowser__pseudo3_N2E3:AO353_20560
MTTVRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQIFD
ALRWLGINWSEGPDVGGPHGPYRQSERGDIYQKYCQQLVDLGHAFPCFCTSDELDQMRAE
QMARGETPRYDGRALLLSKEEVARRLAAGEPHVIRMKVPTEGVCVVPDMLRGDVEIPWDR
MDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWEQPELCY
MPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREKFSLQEMVDN
FDLKRVSLGGPIFDIEKLSWLNGQWLRDLPVEEFASRVQAWALNPEYMMKIAPHVQGRVE
TFSQIAPLAGFFFAGGVTPDAKLFESKKLSGDQVRQLMQLILWKLESLRQWEKDSITATI
QAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQAIDLLGGVSKK
ENKEWEKLLGAIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory