SitesBLAST
Comparing AO353_20700 FitnessBrowser__pseudo3_N2E3:AO353_20700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gegA Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum (see paper)
41% identity, 94% coverage: 14:256/258 of query aligns to 2:230/241 of 3gegA
- active site: S132 (= S147), Y145 (= Y160), K149 (= K164)
- binding nicotinamide-adenine-dinucleotide: G8 (= G20), H11 (≠ R23), I13 (= I25), D32 (= D44), I33 (≠ L45), R37 (= R49), D54 (= D67), V55 (= V68), N81 (= N94), C83 (≠ A96), R84 (≠ V97), I130 (≠ L145), A131 (= A146), S132 (= S147), Y145 (= Y160), K149 (= K164), P174 (= P189), G175 (= G190), I177 (= I192), V179 (≠ T194)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
43% identity, 93% coverage: 13:251/258 of query aligns to 5:237/240 of 2d1yA
- active site: G16 (= G24), S135 (= S147), N145 (≠ T157), Y148 (= Y160), K152 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), R15 (= R23), I17 (= I25), D36 (= D44), L37 (= L45), R38 (= R47), V55 (≠ M66), D56 (= D67), L57 (≠ V68), N83 (= N94), A84 (= A95), A85 (= A96), I86 (≠ V97), V133 (≠ L145), S135 (= S147), Y148 (= Y160), K152 (= K164), P178 (= P189), G179 (= G190), I181 (= I192), T183 (= T194), A185 (≠ D196), V186 (≠ P197)
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
42% identity, 94% coverage: 13:255/258 of query aligns to 6:247/253 of 7xqmB
- binding s-adenosyl-l-homocysteine: G13 (= G20), I16 (= I25), D34 (= D44), L35 (= L45), R36 (= R47), V53 (≠ M66), L55 (≠ V68), N81 (= N94), A82 (= A95), A83 (= A96), Y146 (= Y160)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
34% identity, 93% coverage: 13:252/258 of query aligns to 7:252/261 of 1g6kA
- active site: G18 (= G24), S145 (= S147), Y158 (= Y160), K162 (= K164)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ R23), G18 (= G24), L19 (≠ I25), R39 (vs. gap), D65 (= D67), V66 (= V68), N92 (= N94), A93 (= A95), G94 (≠ A96), M143 (≠ L145), S145 (= S147), Y158 (= Y160), P188 (= P189), G189 (= G190), I191 (= I192), T193 (= T194)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
35% identity, 93% coverage: 12:250/258 of query aligns to 4:241/244 of 7krmC
- active site: G18 (= G24), S140 (≠ T148), Y155 (= Y160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (vs. gap), G18 (= G24), I19 (= I25), D38 (= D44), L39 (= L45), A60 (≠ M66), N61 (≠ D67), V62 (= V68), N88 (= N94), V111 (= V119), S140 (≠ T148), Y155 (= Y160), K159 (= K164), I188 (= I192), T190 (= T194)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
33% identity, 93% coverage: 13:252/258 of query aligns to 7:252/261 of P40288
- 11:35 (vs. 17:41, 32% identical) binding
- E96 (≠ A98) mutation E->A,G,K: Heat stable.
- D108 (≠ Y112) mutation to N: Heat stable.
- V112 (= V116) mutation to A: Heat stable.
- E133 (≠ A137) mutation to K: Heat stable.
- V183 (= V184) mutation to I: Heat stable.
- P194 (≠ R195) mutation to Q: Heat stable.
- E210 (≠ H210) mutation to K: Heat stable.
- Y217 (≠ R217) mutation to H: Heat stable.
- Q252 (≠ K252) mutation to L: Heat stable.
Sites not aligning to the query:
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
35% identity, 94% coverage: 13:255/258 of query aligns to 10:255/258 of 4wecA
- active site: G21 (= G24), S143 (= S147), Q154 (≠ E158), Y157 (= Y160), K161 (= K164)
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), A19 (= A22), S20 (≠ R23), G21 (= G24), I22 (= I25), D41 (= D44), I42 (≠ L45), V61 (≠ M66), D62 (= D67), V63 (= V68), N89 (= N94), T141 (≠ L145), Y157 (= Y160), K161 (= K164), P187 (= P189), P189 (≠ W191), V190 (≠ I192)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
33% identity, 92% coverage: 14:251/258 of query aligns to 8:246/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
33% identity, 92% coverage: 14:251/258 of query aligns to 8:246/255 of 2dteA
- active site: G18 (= G24), S132 (= S147), Y145 (= Y160), S148 (= S163), K149 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), S16 (≠ A22), M17 (≠ R23), G18 (= G24), I19 (= I25), S38 (≠ D44), I39 (≠ L45), C52 (≠ M66), D53 (= D67), V54 (= V68), N80 (= N94), A81 (= A95), I130 (≠ L145), S132 (= S147), Y145 (= Y160), K149 (= K164), P174 (= P189), A175 (≠ G190), T176 (≠ W191), I177 (= I192), T179 (= T194), P180 (= P197), L181 (≠ A198), V182 (≠ T199)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
33% identity, 93% coverage: 14:252/258 of query aligns to 14:258/267 of 3ay6B
- active site: G24 (= G24), S151 (= S147), Y164 (= Y160), K168 (= K164)
- binding beta-D-glucopyranose: E102 (≠ A98), S151 (= S147), H153 (≠ R149), W158 (≠ E154), Y164 (= Y160), N202 (≠ P197), K205 (≠ R200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G20), T23 (≠ R23), G24 (= G24), L25 (≠ I25), Y45 (≠ L45), D71 (= D67), V72 (= V68), N98 (= N94), A99 (= A95), G100 (≠ A96), V101 (= V97), M149 (≠ L145), S151 (= S147), Y164 (= Y160), K168 (= K164), P194 (= P189), G195 (= G190), M197 (≠ I192), T199 (= T194), P200 (≠ R195), I201 (≠ D196), N202 (≠ P197)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 93% coverage: 12:251/258 of query aligns to 4:246/248 of 6ixmC
- active site: G16 (= G24), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (≠ R23), G16 (= G24), I17 (= I25), D36 (= D44), I37 (≠ L45), A61 (≠ M66), D62 (= D67), T63 (≠ V68), N89 (≠ A95), A90 (= A96), M140 (≠ L145), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P189), A186 (≠ G190), Y187 (≠ W191), I188 (= I192), L192 (≠ D196)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 92% coverage: 14:251/258 of query aligns to 8:253/255 of 5itvA
- active site: G18 (= G24), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), S17 (≠ R23), G18 (= G24), I19 (= I25), D38 (= D44), I39 (≠ L45), T61 (≠ M66), I63 (≠ V68), N89 (= N94), G91 (≠ A96), T139 (≠ L145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P189), G185 (= G190), I186 (≠ W191), I187 (= I192)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
35% identity, 93% coverage: 13:252/258 of query aligns to 6:246/247 of 3rwbA
- active site: G17 (= G24), S140 (= S147), Y153 (= Y160), K157 (= K164)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S147), N141 (≠ T148), T142 (≠ R149), M150 (≠ T157), Y153 (= Y160), L185 (≠ W191), H196 (≠ R201)
- binding nicotinamide-adenine-dinucleotide: G13 (= G20), Q16 (≠ R23), G17 (= G24), I18 (= I25), D37 (= D44), I38 (≠ L45), D60 (= D67), I61 (≠ V68), N87 (= N94), A88 (= A95), S89 (≠ A96), I138 (≠ L145), S140 (= S147), Y153 (= Y160), K157 (= K164), P183 (= P189), L185 (≠ W191), I186 (= I192), S188 (≠ T194), G190 (≠ D196), V191 (vs. gap)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
35% identity, 93% coverage: 13:252/258 of query aligns to 6:246/247 of 3ndrA
- active site: G17 (= G24), S140 (= S147), Y153 (= Y160), K157 (= K164)
- binding nicotinamide-adenine-dinucleotide: G13 (= G20), Q16 (≠ R23), G17 (= G24), I18 (= I25), D37 (= D44), I38 (≠ L45), D60 (= D67), I61 (≠ V68), N87 (= N94), A88 (= A95), S89 (≠ A96), V110 (= V119), I138 (≠ L145), S140 (= S147), Y153 (= Y160), K157 (= K164), P183 (= P189), L185 (≠ W191), I186 (= I192), S188 (≠ T194), G190 (≠ D196), V191 (vs. gap)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
34% identity, 92% coverage: 14:250/258 of query aligns to 6:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), Q15 (≠ R23), G16 (= G24), I17 (= I25), D36 (= D44), V63 (= V68), N89 (= N94), A91 (= A96), S94 (≠ D99), I142 (≠ L145), S143 (≠ A146), S144 (= S147), Y157 (= Y160), K161 (= K164), P187 (= P189), H188 (≠ G190), I190 (= I192), I194 (≠ D196)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
40% identity, 93% coverage: 12:251/258 of query aligns to 4:249/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), G16 (= G24), I17 (= I25), D36 (= D44), L37 (= L45), C61 (≠ M66), D62 (= D67), V63 (= V68), N89 (= N94), A90 (= A95), T140 (≠ L145), S142 (= S147), Y155 (= Y160), K159 (= K164), A186 (≠ G190), V187 (≠ W191)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 93% coverage: 14:253/258 of query aligns to 8:227/227 of 5itvD
- active site: G18 (= G24), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), S17 (≠ R23), G18 (= G24), I19 (= I25), D38 (= D44), I39 (≠ L45), T61 (≠ M66), D62 (= D67), I63 (≠ V68), N89 (= N94), T139 (≠ L145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P189), G185 (= G190), I187 (= I192)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
34% identity, 92% coverage: 13:249/258 of query aligns to 9:247/251 of 6d9yB
- active site: G20 (= G24), S145 (= S147), Y158 (= Y160)
- binding nicotinamide-adenine-dinucleotide: G16 (= G20), R19 (= R23), G20 (= G24), D40 (= D44), L41 (= L45), V64 (≠ M66), D65 (= D67), Q66 (≠ V68), A93 (= A95), S145 (= S147), Y158 (= Y160), K162 (= K164), P188 (= P189), A189 (≠ G190), A190 (≠ W191), A191 (≠ I192), T193 (= T194)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
35% identity, 92% coverage: 14:251/258 of query aligns to 3:248/250 of 2cfcA
- active site: G13 (= G24), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ E154), R152 (≠ T157), Y155 (= Y160), W195 (≠ T199), R196 (= R200)
- binding nicotinamide-adenine-dinucleotide: G9 (= G20), S12 (≠ R23), G13 (= G24), N14 (≠ I25), D33 (= D44), L34 (= L45), A59 (≠ M66), D60 (= D67), V61 (= V68), N87 (= N94), A88 (= A95), G89 (≠ A96), I140 (≠ L145), P185 (= P189), G186 (= G190), M187 (≠ W191), I188 (= I192), T190 (= T194), P191 (≠ R195), M192 (≠ D196), T193 (≠ P197)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
35% identity, 92% coverage: 14:251/258 of query aligns to 3:248/250 of Q56840
- SGN 12:14 (≠ RGI 23:25) binding
- D33 (= D44) binding
- DV 60:61 (= DV 67:68) binding
- N87 (= N94) binding
- S142 (= S147) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ T157) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y160) mutation Y->E,F: Loss of activity.
- K159 (= K164) mutation to A: Loss of activity.
- R179 (= R183) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IDTRD 192:196) binding
- WR 195:196 (≠ TR 199:200) binding
- R196 (= R200) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ S206) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ Q212) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>AO353_20700 FitnessBrowser__pseudo3_N2E3:AO353_20700
VIELSAPASGANGRVALVTGAARGIGLGIAAWLVSEGWQVVLTDLDRARGSKVAKVLGDN
ACFIGMDVADEQQVAQGVAEVLGQFGRIDALVCNAAVADPHNITLESLDLAYWNRVLAVN
LSGPMLLAKHCAPYLRAHSGAIVNLASTRAAQSEPDTEAYAASKGGLLALTHALAISLGP
EIRVNAVSPGWIDTRDPATRRAEPLSDADHAQHPAGRVGTVEDVAAMVAWLLSKNAGFVT
GQEFVVDGGMTKKMIYGD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory