SitesBLAST
Comparing AO353_20720 FitnessBrowser__pseudo3_N2E3:AO353_20720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 62% coverage: 124:386/427 of query aligns to 92:349/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y284), R302 (≠ F341), R329 (≠ G366)
- binding flavin-adenine dinucleotide: V174 (≠ A209), S202 (≠ G236), G203 (≠ N237), W205 (≠ Y239), F209 (≠ L243), G300 (= G339), R302 (≠ F341), H327 (≠ C364), R329 (≠ G366), N330 (≠ H367), G331 (= G368), I332 (≠ V369)
- binding phosphate ion: R254 (= R296)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 62% coverage: 124:386/427 of query aligns to 92:349/369 of O31616
- V174 (≠ A209) binding
- H244 (≠ Y277) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ F341) binding
- 327:333 (vs. 364:370, 14% identical) binding
- R329 (≠ G366) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
23% identity, 62% coverage: 124:386/427 of query aligns to 92:349/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (= P208), V174 (≠ A209), S202 (≠ G236), G203 (≠ N237), W205 (≠ Y239), F209 (≠ L243), G300 (= G339), R302 (≠ F341), H327 (≠ C364), F328 (≠ S365), R329 (≠ G366), N330 (≠ H367), G331 (= G368), I332 (≠ V369)
- binding glycolic acid: Y246 (= Y284), R302 (≠ F341), R329 (≠ G366)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 50% coverage: 182:393/427 of query aligns to 147:359/369 of S5FMM4
- S202 (≠ G236) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ V369) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L379) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
22% identity, 63% coverage: 16:285/427 of query aligns to 31:293/857 of Q63342
- CV 52:53 (≠ YT 39:40) binding
- EK 73:74 (≠ EA 59:60) binding
- 80:88 (vs. 66:75, 20% identical) binding
- H84 (≠ R70) modified: Tele-8alpha-FAD histidine
- V212 (≠ A209) binding
- W244 (≠ Y239) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
21% identity, 63% coverage: 19:285/427 of query aligns to 39:300/866 of Q9UI17
- CV 59:60 (≠ YT 39:40) binding
- EK 80:81 (≠ EA 59:60) binding
- 87:95 (vs. 66:75, 20% identical) binding
- H91 (≠ R70) modified: Tele-8alpha-FAD histidine
- H109 (≠ G91) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (≠ A209) binding
- S279 (≠ G265) to P: in dbSNP:rs532964
Sites not aligning to the query:
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
22% identity, 61% coverage: 25:285/427 of query aligns to 3:256/824 of 4pabB
- active site: T53 (≠ N77), E102 (≠ H138), H226 (≠ T256), Y255 (= Y284)
- binding flavin-adenine dinucleotide: I11 (= I35), G12 (= G36), G14 (= G38), C15 (≠ Y39), V16 (≠ T40), L35 (= L58), E36 (= E59), K37 (≠ A60), G43 (= G66), S44 (≠ A67), T45 (≠ S68), H47 (≠ R70), A48 (≠ N71), A49 (≠ G72), G50 (= G73), L51 (≠ I75), V175 (≠ A209), A204 (≠ G236), G205 (≠ N237), W207 (≠ Y239), H226 (≠ T256), Y228 (≠ V258)
Sites not aligning to the query:
- active site: 536
- binding flavin-adenine dinucleotide: 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Query Sequence
>AO353_20720 FitnessBrowser__pseudo3_N2E3:AO353_20720
MANTPYPESYYAASANAAPLRPMLQDDVETDICVIGAGYTGLSSALFLLESGFRVTVLEA
AKVGFGASGRNGGQIVNSYSRDIDVIERSVGPKQAQMLGQMAFEGGKIIRDRVARYQIQC
DLKDGGVFAAITSKQMGHLESQKRLWERYGHTQLELLDKRRIREVVACDQYVGGMLDMSG
GHIHPLNLALGEAAAVESLGGTIYEQSPAIRIERGANPVVHTPQGKVRAKFIIVAGNAYL
GNLVPELAAKSMPCGTQVITTEPLGDELAKSLLPQDYCVEDCNYLLDYYRLSGDKRLIFG
GGVVYGARDPANIEAIIRPKMLKAFPQLEDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYY
SQGCSGHGVTYTHLAGKVLAEALRGQAERFDAFADLPHYPFPGGQLLRTPFAALGAWYYG
LRDKFDF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory