SitesBLAST
Comparing AO353_20820 FitnessBrowser__pseudo3_N2E3:AO353_20820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
41% identity, 95% coverage: 8:497/517 of query aligns to 3:491/501 of P04983
- K43 (= K47) mutation to R: Loss of transport.
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of Q97UY8
- S142 (≠ G147) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G149) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E171) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
28% identity, 41% coverage: 9:221/517 of query aligns to 1:221/232 of 1f3oA
7mdyC Lolcde nucleotide-bound
33% identity, 39% coverage: 23:225/517 of query aligns to 21:222/226 of 7mdyC
- binding adp orthovanadate: G42 (= G44), S43 (≠ A45), G44 (= G46), K45 (= K47), S46 (= S48), T47 (= T49), Q91 (= Q90), H138 (≠ T141), E142 (= E145), S144 (≠ G147), G145 (≠ I148), G146 (= G149), E168 (= E171), N172 (≠ M175), H201 (= H203)
- binding magnesium ion: S46 (= S48), Q91 (= Q90)
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 39% coverage: 23:225/517 of query aligns to 21:222/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 39% coverage: 23:225/517 of query aligns to 24:225/233 of P75957
- G42 (= G41) mutation to D: Loss of lipoprotein release when overexpressed.
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
28% identity, 41% coverage: 9:221/517 of query aligns to 1:221/230 of 1l2tA
- binding adenosine-5'-triphosphate: Y11 (= Y19), S40 (≠ N43), G41 (= G44), S42 (≠ A45), G43 (= G46), K44 (= K47), S45 (= S48), T46 (= T49), F138 (≠ D138), Q145 (≠ E145), S147 (≠ G147), G149 (= G149), Q150 (≠ H150), H204 (= H203)
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
32% identity, 39% coverage: 23:225/517 of query aligns to 23:224/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: V23 (= V23), S43 (≠ N43), G44 (= G44), G46 (= G46), K47 (= K47), S48 (= S48), T49 (= T49), Q93 (= Q90), R137 (≠ D138), H140 (≠ T141), E144 (= E145), S146 (≠ G147), G148 (= G149), E149 (≠ H150), H203 (= H203)
- binding magnesium ion: S48 (= S48), Q93 (= Q90)
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
31% identity, 40% coverage: 23:228/517 of query aligns to 23:226/650 of 5ws4A
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
30% identity, 41% coverage: 9:221/517 of query aligns to 3:218/226 of 5xu1B
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
25% identity, 42% coverage: 9:225/517 of query aligns to 4:230/253 of 1g9xB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 42% coverage: 9:224/517 of query aligns to 1:215/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y19), V16 (= V23), S36 (≠ N43), G37 (= G44), S38 (≠ A45), G39 (= G46), K40 (= K47), S41 (= S48), T42 (= T49), E162 (= E171), H194 (= H203)
- binding magnesium ion: S41 (= S48), E162 (= E171)
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 39% coverage: 23:225/517 of query aligns to 22:222/615 of 5lilA
- binding adenosine-5'-triphosphate: V22 (= V23), S42 (≠ N43), G43 (= G44), G45 (= G46), K46 (= K47), S47 (= S48), T48 (= T49), Q92 (= Q90), K136 (vs. gap), Q143 (≠ T141), S145 (≠ V143), G147 (= G149), Q148 (≠ H150)
- binding magnesium ion: S47 (= S48), Q92 (= Q90)
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
25% identity, 42% coverage: 9:225/517 of query aligns to 4:230/254 of 1g6hA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 39% coverage: 23:225/517 of query aligns to 22:222/592 of 5lj7A
- binding adenosine-5'-triphosphate: V22 (= V23), S42 (≠ N43), G43 (= G44), G45 (= G46), K46 (= K47), S47 (= S48), T48 (= T49), Q92 (= Q90), K136 (vs. gap), Q143 (≠ T141), S145 (≠ V143), G147 (= G149), Q148 (≠ H150)
- binding magnesium ion: S47 (= S48), Q92 (= Q90)
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
30% identity, 42% coverage: 10:226/517 of query aligns to 899:1112/2261 of O95477
- D917 (= D28) to Y: in a colorectal cancer sample; somatic mutation
- T929 (≠ L37) to I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane
- N935 (= N43) to S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- K939 (= K47) mutation to M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- S1042 (≠ E155) modified: Phosphoserine; by PKA
- P1065 (≠ A178) natural variant: P -> S
- M1091 (≠ L205) to T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
- C1110 (≠ V224) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- C1111 (= C225) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 1925 R → Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- 1952 K→M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- 2054 modified: Phosphoserine; by PKA
- 2081 R → W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- 2109 A → T: in a colorectal cancer sample; somatic mutation
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 42% coverage: 9:223/517 of query aligns to 17:226/378 of P69874
- C26 (≠ T18) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y19) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ V36) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A45) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ S51) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ F67) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V132) mutation to M: Loss of ATPase activity and transport.
- D172 (= D170) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
Query Sequence
>AO353_20820 FitnessBrowser__pseudo3_N2E3:AO353_20820
MSVCAPNAVLSVSGIGKTYAQPVLTGIDLTLMRGEVLALTGENGAGKSTLSKIIGGLVTP
TTGQMQFQGRDYRPGSRTQAEELGIRMVMQELNLLPTLSVAENLFLDNLPSNGGWISRKQ
LRKAAIAAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTARE
VEMLFEQITRLQARGVAIIYISHRLEELARVAQRIAVLRDGNLVCVEPMANYNSEQLVNL
MVGRELGEHIDLGPRHIGAPALTVKGLSRSDKVRDVSFEVRSGEIFGISGLIGAGRTELL
RLIFGADAADSGTVALGSPAQVVSIRSPADAVGHGIALITEDRKGEGLLLTQSISANIAL
GNMPVISSGGIVNSGDEMALAQRQIDAMRIRSSSPAQLVSELSGGNQQKVVIGRWLEREC
SVLLFDEPTRGIDVGAKFDIYALLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGRLI
DTFERDSWTQDDLLAAAFAGYQKRDALLHEAAPRDLP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory