SitesBLAST
Comparing AO353_21135 FitnessBrowser__pseudo3_N2E3:AO353_21135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2c20A Crystal structure of udp-glucose 4-epimerase
48% identity, 99% coverage: 3:323/325 of query aligns to 3:324/329 of 2c20A
- active site: T117 (≠ S116), A118 (= A117), A119 (= A118), Y141 (= Y140), K145 (= K144), H184 (≠ R183)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), Q34 (≠ S34), T35 (= T35), G36 (= G36), D51 (= D50), L52 (≠ I51), F73 (= F72), A74 (= A73), A75 (≠ S74), N92 (= N91), Y141 (= Y140), K145 (= K144), Y168 (= Y167), F169 (= F168), V171 (≠ A170), H184 (≠ R183)
- binding zinc ion: E182 (= E181), H184 (≠ R183), E187 (= E186), H189 (= H188)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
51% identity, 96% coverage: 2:312/325 of query aligns to 3:313/325 of 4twrA
- active site: S117 (= S116), C118 (≠ A117), A119 (= A118), Y141 (= Y140), K145 (= K144), H184 (≠ R183), H189 (= H188)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (≠ Y11), I13 (= I12), D32 (= D31), N33 (= N32), L34 (≠ F33), S35 (= S34), T36 (= T35), G37 (= G36), D51 (= D50), I52 (= I51), F73 (= F72), A74 (= A73), A75 (≠ S74), N92 (= N91), S115 (= S114), K145 (= K144), Y168 (= Y167), A171 (= A170), H184 (≠ R183)
- binding zinc ion: E182 (= E181), H184 (≠ R183), E187 (= E186), H189 (= H188)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
44% identity, 98% coverage: 2:321/325 of query aligns to 3:328/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), S35 (= S34), G37 (= G36), D57 (= D50), L58 (≠ I51), F79 (= F72), A80 (= A73), I83 (≠ T76), N98 (= N91), Y147 (= Y140), K151 (= K144), Y175 (= Y167), N177 (= N169), V178 (≠ A170)
1gy8C Trypanosoma brucei udp-galactose 4' epimerase (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 3:366/370 of 1gy8C
- active site: S144 (= S116), A145 (= A117), A146 (= A118), Y170 (= Y140), K174 (= K144)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D34 (= D31), S35 (≠ N32), L36 (≠ F33), V37 (≠ S34), G38 (≠ T35), D77 (= D53), V78 (≠ A54), M100 (≠ F72), C101 (≠ A73), A102 (≠ S74), L104 (≠ T76), N119 (= N91), S142 (= S114), S143 (= S115), S144 (= S116), Y170 (= Y140), K174 (= K144), Y197 (= Y167), A200 (= A170)
- binding uridine-5'-diphosphate: N199 (= N169), H218 (= H188), L219 (= L189), I222 (≠ L192), M241 (≠ I204), P242 (≠ T205), I243 (≠ V206), F244 (≠ Y207), C255 (= C218), R257 (= R220), R324 (= R281), D327 (= D284)
2cnbA Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with NAD and the substrate analogue udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 3:362/366 of 2cnbA
- active site: S144 (= S116), A145 (= A117), A146 (= A118), Y169 (= Y140), K173 (= K144)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D34 (= D31), S35 (≠ N32), V37 (≠ S34), G38 (≠ T35), D77 (= D53), V78 (≠ A54), M100 (≠ F72), C101 (≠ A73), A102 (≠ S74), L104 (≠ T76), N119 (= N91), S143 (= S115), S144 (= S116), Y169 (= Y140), K173 (= K144), Y196 (= Y167), F197 (= F168), A199 (= A170)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: L104 (≠ T76), S144 (= S116), Y169 (= Y140), F197 (= F168), N198 (= N169), H217 (= H188), L218 (= L189), P238 (≠ T205), I239 (≠ V206), F240 (≠ Y207), C251 (= C218), R253 (= R220), V297 (= V258), R320 (= R281), D323 (= D284)
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
43% identity, 99% coverage: 2:323/325 of query aligns to 4:341/346 of 1ek6A
- active site: S132 (= S116), A133 (= A117), T134 (≠ A118), Y157 (= Y140), K161 (= K144)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D33 (= D31), N34 (= N32), H36 (≠ S34), N37 (≠ T35), D66 (= D50), I67 (= I51), F88 (= F72), A89 (= A73), G90 (≠ S74), K92 (≠ T76), S130 (= S114), S131 (= S115), S132 (= S116), Y157 (= Y140), K161 (= K144), Y185 (= Y167), P188 (≠ A170)
- binding uridine-5'-diphosphate-glucose: S132 (= S116), Y157 (= Y140), F186 (= F168), N187 (= N169), N207 (≠ H188), L208 (= L189), N224 (≠ T205), V225 (= V206), F226 (≠ Y207), R239 (= R220), Y241 (= Y222), V277 (= V258), R300 (= R281), D303 (= D284)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
43% identity, 99% coverage: 2:323/325 of query aligns to 4:341/348 of Q14376
- GYI 12:14 (= GYI 10:12) binding
- DNFHN 33:37 (≠ DNFST 31:35) binding
- N34 (= N32) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (= DI 50:51) binding
- F88 (= F72) binding
- G90 (≠ S74) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ T76) binding
- V94 (= V78) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ K87) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S116) mutation to A: Loss of activity.
- SAT 132:134 (≠ SAA 116:118) binding
- Y157 (= Y140) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K144) binding
- A180 (≠ S162) to V: in dbSNP:rs3204468
- L183 (= L165) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y167) binding
- YFN 185:187 (= YFN 167:169) binding
- NNL 206:208 (≠ THL 187:189) binding
- NVF 224:226 (≠ TVY 205:207) binding
- R239 (= R220) binding
- K257 (≠ Y238) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RVGD 281:284) binding
- C307 (≠ L288) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ M294) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G300) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ S317) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
43% identity, 99% coverage: 2:323/325 of query aligns to 3:340/345 of 1hzjA
- active site: S131 (= S116), A132 (= A117), T133 (≠ A118), Y156 (= Y140), K160 (= K144)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ S34), N36 (≠ T35), D65 (= D50), I66 (= I51), F87 (= F72), A88 (= A73), G89 (≠ S74), K91 (≠ T76), S129 (= S114), S131 (= S116), Y156 (= Y140), K160 (= K144), Y184 (= Y167), P187 (≠ A170)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N169), N206 (≠ H188), L207 (= L189), N223 (≠ T205), V224 (= V206), F225 (≠ Y207), R238 (= R220), Y240 (= Y222), V276 (= V258), R299 (= R281), D302 (= D284)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
43% identity, 99% coverage: 2:323/325 of query aligns to 3:340/347 of 1i3lA
- active site: S131 (= S116), A132 (= A117), T133 (≠ A118), Y156 (= Y140), K160 (= K144)
- binding galactose-uridine-5'-diphosphate: N186 (= N169), N206 (≠ H188), L207 (= L189), N223 (≠ T205), V224 (= V206), F225 (≠ Y207), R238 (= R220), Y240 (= Y222), V276 (= V258), R299 (= R281), D302 (= D284)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ S34), N36 (≠ T35), D65 (= D50), I66 (= I51), F87 (= F72), A88 (= A73), G89 (≠ S74), K91 (≠ T76), S129 (= S114), S130 (= S115), S131 (= S116), Y156 (= Y140), K160 (= K144), Y184 (= Y167), P187 (≠ A170)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
43% identity, 99% coverage: 2:323/325 of query aligns to 3:340/347 of 1i3kA
- active site: S131 (= S116), A132 (= A117), T133 (≠ A118), Y156 (= Y140), K160 (= K144)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ S34), N36 (≠ T35), D65 (= D50), I66 (= I51), F87 (= F72), A88 (= A73), G89 (≠ S74), K91 (≠ T76), S129 (= S114), S131 (= S116), Y156 (= Y140), K160 (= K144), Y184 (= Y167), P187 (≠ A170)
- binding uridine-5'-diphosphate-glucose: F185 (= F168), N186 (= N169), N206 (≠ H188), L207 (= L189), N223 (≠ T205), V224 (= V206), F225 (≠ Y207), R238 (= R220), Y240 (= Y222), V276 (= V258), R299 (= R281), D302 (= D284)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 1:333/338 of 2udpA
- active site: S124 (= S116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144), M189 (≠ L179)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ F33), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D50), I59 (= I51), F80 (= F72), A81 (= A73), G82 (≠ S74), K84 (≠ T76), S122 (= S114), S124 (= S116), Y149 (= Y140), K153 (= K144), Y177 (= Y167)
- binding phenyl-uridine-5'-diphosphate: N179 (= N169), N199 (≠ H188), L200 (= L189), A216 (≠ T205), I217 (≠ V206), F218 (≠ Y207), R231 (= R220), Y233 (= Y222), V269 (= V258), R292 (= R281), D295 (= D284)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 1:333/338 of 1udcA
- active site: S124 (= S116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144), M189 (≠ L179)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D50), I59 (= I51), F80 (= F72), A81 (= A73), G82 (≠ S74), K84 (≠ T76), S122 (= S114), Y149 (= Y140), K153 (= K144), Y177 (= Y167), P180 (≠ A170)
- binding uridine-5'-diphosphate-mannose: T126 (≠ A118), Y149 (= Y140), N179 (= N169), N199 (≠ H188), L200 (= L189), L215 (≠ I204), A216 (≠ T205), I217 (≠ V206), F218 (≠ Y207), R231 (= R220), Y233 (= Y222), V269 (= V258), R292 (= R281)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
41% identity, 99% coverage: 1:323/325 of query aligns to 1:333/338 of P09147
- YI 11:12 (= YI 11:12) binding
- DNLCNS 31:36 (≠ DNFSTG 31:36) binding
- DI 58:59 (= DI 50:51) binding
- FAGLK 80:84 (≠ FASFT 72:76) binding
- N99 (= N91) binding
- S124 (= S116) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y140) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K144) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F168) binding
- Y299 (≠ L288) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
Q564Q1 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Caenorhabditis elegans (see paper)
39% identity, 99% coverage: 1:323/325 of query aligns to 1:344/349 of Q564Q1
- P314 (= P292) mutation to L: In pv18; at the restrictive temperature of 25 degrees Celsius, embryos have cell-cell adhesion defects and die before hatching. The few surviving animals are arrested at the L1 larval stage. At the permissive temperature of 16-20 degrees Celsius, causes a developmental delay. Distal tip cell migration is impaired due to a reduced localization of metalloprotease mig-17 to the gonad basement membrane. Vulva lumen is smaller at the L4 larval stage. Accumulation of UDP-galactose (Gal) and reduction in UDP-N-acetylgalactosamine (GalNAc) levels. Hypersensitivity to a galactose-rich diet characterized by a slow development often resulting in an arrest at the L1 larval stage. Up-regulation of ER stress response protein hsp-4; expression is suppressed in an xbp-1 RNAi-mediated knockdown animals. Reduced survival upon E.faecalis or S.aureus-mediated infection.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 1:333/338 of 1udaA
- active site: S124 (= S116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144), M189 (≠ L179)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ F33), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D50), I59 (= I51), F80 (= F72), A81 (= A73), G82 (≠ S74), K84 (≠ T76), S122 (= S114), Y149 (= Y140), K153 (= K144), Y177 (= Y167), P180 (≠ A170)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ A118), N179 (= N169), N199 (≠ H188), L200 (= L189), A216 (≠ T205), I217 (≠ V206), F218 (≠ Y207), R231 (= R220), Y233 (= Y222), R292 (= R281), D295 (= D284), Y299 (≠ L288)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 1:333/338 of 1naiA
- active site: S124 (= S116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144), M189 (≠ L179)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ F33), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D50), I59 (= I51), F80 (= F72), A81 (= A73), G82 (≠ S74), K84 (≠ T76), Y149 (= Y140), K153 (= K144), Y177 (= Y167), P180 (≠ A170)
- binding 1,3-propandiol: N35 (≠ T35), K84 (≠ T76), E191 (= E181), P193 (= P185)
- binding uridine-5'-diphosphate: N179 (= N169), N199 (≠ H188), L200 (= L189), L215 (≠ I204), A216 (≠ T205), R231 (= R220), Y233 (= Y222), R292 (= R281)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 1:333/338 of 1lrjA
- active site: S124 (= S116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144), M189 (≠ L179)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ F33), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D50), I59 (= I51), F80 (= F72), A81 (= A73), G82 (≠ S74), K84 (≠ T76), Y149 (= Y140), K153 (= K144), Y177 (= Y167), P180 (≠ A170)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V78), S124 (= S116), F178 (= F168), N179 (= N169), L200 (= L189), L215 (≠ I204), A216 (≠ T205), F218 (≠ Y207), R231 (= R220), Y233 (= Y222), V269 (= V258), R292 (= R281), D295 (= D284)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 1:333/338 of 1kvrA
- active site: A124 (≠ S116), A125 (= A117), T126 (≠ A118), Y149 (= Y140), K153 (= K144), M189 (≠ L179)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D50), I59 (= I51), F80 (= F72), A81 (= A73), G82 (≠ S74), K84 (≠ T76), S122 (= S114), S123 (= S115), Y149 (= Y140), K153 (= K144), Y177 (= Y167), P180 (≠ A170)
- binding uridine-5'-diphosphate: N179 (= N169), N198 (≠ T187), N199 (≠ H188), L200 (= L189), A216 (≠ T205), I217 (≠ V206), F218 (≠ Y207), R231 (= R220), Y233 (= Y222), V269 (= V258), R292 (= R281), D295 (= D284)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
41% identity, 99% coverage: 1:323/325 of query aligns to 1:333/338 of 1a9yA
- active site: A124 (≠ S116), A125 (= A117), T126 (≠ A118), F149 (≠ Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D50), I59 (= I51), F80 (= F72), A81 (= A73), G82 (≠ S74), K84 (≠ T76), S122 (= S114), S123 (= S115), F149 (≠ Y140), K153 (= K144), Y177 (= Y167), P180 (≠ A170)
- binding uridine-5'-diphosphate-glucose: A125 (= A117), T126 (≠ A118), N179 (= N169), N199 (≠ H188), L200 (= L189), A216 (≠ T205), I217 (≠ V206), F218 (≠ Y207), R231 (= R220), Y233 (= Y222), R292 (= R281), D295 (= D284), Y299 (≠ L288)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 98% coverage: 4:320/325 of query aligns to 74:403/419 of Q9SA77
- G275 (≠ P191) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R220) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
Query Sequence
>AO353_21135 FitnessBrowser__pseudo3_N2E3:AO353_21135
MKFLVVGGAGYIGSHMVKQLLRAGHEPVVADNFSTGHRGALMGGRLVELDIADAQALDVL
FAGQHFDAVFHFASFTQVGESVTEPAKYYQNNLAGTLTLLQAVVRAGVKNFIFSSSAAIY
GDPVYVPIDEEHPKAAINPYGRSKWMVEQMLEDFDRAYGLKSVCLRYFNAAGADPEGQLG
ERREPETHLLPLILQAASGRRTTITVYGRDYDTPDGTCIRDYIHVVDLVAAHALAVNYLL
AGGASTALNLGNGQGFSVQQVIDTARAVTGQGISVSEAPRRVGDPPRLVADPRMANTLLG
WQPQYASLEQIVAHAWSWEQKYPWH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory