Comparing AO353_21195 FitnessBrowser__pseudo3_N2E3:AO353_21195 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
33% identity, 94% coverage: 3:165/174 of query aligns to 101:270/280 of 7bw9A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
37% identity, 83% coverage: 19:162/174 of query aligns to 109:246/272 of 3gvdI
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
36% identity, 83% coverage: 19:162/174 of query aligns to 105:242/246 of 8i09A
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
36% identity, 83% coverage: 19:162/174 of query aligns to 102:239/258 of 8i04A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
36% identity, 83% coverage: 19:162/174 of query aligns to 106:243/244 of 8i06A
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
34% identity, 83% coverage: 19:162/174 of query aligns to 98:232/233 of 4n6bA
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
35% identity, 83% coverage: 19:162/174 of query aligns to 106:243/262 of 1t3dA
Sites not aligning to the query:
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
33% identity, 83% coverage: 19:162/174 of query aligns to 105:242/243 of 4n69A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
34% identity, 90% coverage: 5:160/174 of query aligns to 82:242/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
34% identity, 90% coverage: 5:160/174 of query aligns to 80:240/243 of 7ra4A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
32% identity, 86% coverage: 19:168/174 of query aligns to 102:245/257 of 1ssqD
Sites not aligning to the query:
1sstA Serine acetyltransferase- complex with coa (see paper)
33% identity, 83% coverage: 19:162/174 of query aligns to 102:232/233 of 1sstA
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
32% identity, 87% coverage: 19:169/174 of query aligns to 102:246/258 of 4h7oA
Sites not aligning to the query:
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
33% identity, 87% coverage: 4:154/174 of query aligns to 104:267/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
33% identity, 87% coverage: 4:154/174 of query aligns to 102:265/267 of 3q1xA
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
31% identity, 83% coverage: 19:162/174 of query aligns to 106:243/250 of 4hzdA
Sites not aligning to the query:
5tyhA Pgld from campylobacter jejuni nctc 11168 in complex with 5-(2- furanyl)-1h-pyrazole-3-carboxylic acid (see paper)
30% identity, 72% coverage: 42:166/174 of query aligns to 52:171/185 of 5tyhA
5t2yA Crystal structure of c. Jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid (see paper)
30% identity, 72% coverage: 42:166/174 of query aligns to 59:178/192 of 5t2yA
Sites not aligning to the query:
3bsyA Pgld from campylobacter jejuni, nctc 11168, in complex with acetyl coenzyme a (see paper)
30% identity, 72% coverage: 42:166/174 of query aligns to 60:179/193 of 3bsyA
Sites not aligning to the query:
3bssA Pgld from campylobacter jejuni, nctc 11168, with native substrate (see paper)
30% identity, 72% coverage: 42:166/174 of query aligns to 61:180/194 of 3bssA
Sites not aligning to the query:
>AO353_21195 FitnessBrowser__pseudo3_N2E3:AO353_21195
MFENIRADLRAYAGDWAAQGFWVMLVYRFGRWRYGVRPAFLRKLFSFIYKVLFKLVQIVT
GIELPCEVVIGRNFVIDHFGGIVISGYAQFGDDCRIRNGVVVGLKNVDEPIAPVMGNNVD
IGAGAKVLGNIRIGNNVVIGANAVVLTDVPDDSVAVGVPATIKKRQRAEARECL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory