SitesBLAST
Comparing AO353_21350 FitnessBrowser__pseudo3_N2E3:AO353_21350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zz7A Crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii (see paper)
61% identity, 96% coverage: 6:487/500 of query aligns to 3:484/489 of 4zz7A
- active site: N149 (= N153), K172 (= K176), L246 (= L250), C280 (= C284), E382 (= E385), A462 (= A465)
- binding nicotinamide-adenine-dinucleotide: T146 (= T150), P147 (= P151), F148 (= F152), N149 (= N153), K172 (= K176), E175 (= E179), K205 (= K209), V208 (= V212), F222 (= F226), V223 (= V227), G224 (= G228), S225 (= S229), I228 (= I232), L246 (= L250), G247 (= G251), C280 (= C284), E382 (= E385), F384 (= F387)
5tjrD X-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. Aac (see paper)
57% identity, 96% coverage: 6:485/500 of query aligns to 2:456/468 of 5tjrD
- active site: N144 (= N153), K167 (= K176), L241 (= L250), C270 (= C284), E356 (= E385), A436 (= A465)
- binding adenosine-5'-diphosphate: I140 (≠ V149), T141 (= T150), F143 (= F152), K167 (= K176), E170 (= E179), K200 (= K209), F217 (= F226), S220 (= S229), I223 (= I232)
4iymC Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with NAD, target 011934
55% identity, 96% coverage: 7:488/500 of query aligns to 7:489/491 of 4iymC
- active site: N153 (= N153), K176 (= K176), F250 (≠ L250), C284 (= C284), E386 (= E385), Q466 (≠ A465)
- binding nicotinamide-adenine-dinucleotide: I149 (≠ V149), T150 (= T150), P151 (= P151), F152 (= F152), N153 (= N153), F154 (= F154), K176 (= K176), K209 (= K209), V212 (= V212), F226 (= F226), V227 (= V227), G228 (= G228), S229 (= S229), I232 (= I232), G251 (= G251), C284 (= C284), E386 (= E385), F388 (= F387)
P42412 Malonate-semialdehyde dehydrogenase; MSA dehydrogenase; Methylmalonate-semialdehyde dehydrogenase; MMSA dehydrogenase; MMSDH; MSDH; EC 1.2.1.27 from Bacillus subtilis (strain 168) (see 3 papers)
43% identity, 99% coverage: 1:495/500 of query aligns to 1:487/487 of P42412
- C36 (≠ A36) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-160; A-287; A-351 and A-413.
- R107 (= R107) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- A150 (≠ T150) binding
- F152 (= F152) binding
- C160 (≠ L160) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-287; A-351 and A-413.
- K176 (= K176) binding
- E179 (= E179) binding
- R180 (= R180) binding
- S229 (= S229) binding
- T251 (≠ G251) binding
- R283 (= R283) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- C287 (≠ I287) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-351 and A-413.
- C351 (≠ V351) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-413.
- E382 (= E385) binding
- C413 (≠ S416) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-351.
1t90A Crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis
43% identity, 97% coverage: 3:485/500 of query aligns to 1:480/484 of 1t90A
- active site: N151 (= N153), K174 (= K176), L248 (= L250), C282 (= C284), E380 (= E385), A460 (= A465)
- binding nicotinamide-adenine-dinucleotide: I147 (≠ V149), A148 (≠ T150), P149 (= P151), F150 (= F152), N151 (= N153), W159 (= W161), K174 (= K176), E177 (= E179), R178 (= R180), H207 (≠ K209), V225 (= V227), G226 (= G228), S227 (= S229), V230 (≠ I232), L248 (= L250), T249 (≠ G251), C282 (= C284), E380 (= E385), F382 (= F387)
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8vqwC
- binding coenzyme a: I147 (≠ V149), W150 (≠ F152), K174 (= K176), S176 (= S178), E177 (= E179), G207 (≠ K209), G211 (vs. gap), F225 (= F226), G227 (= G228), G228 (≠ S229), S231 (≠ I232), H331 (= H331), F387 (= F387)
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8uznA
- binding adenosine monophosphate: I147 (≠ V149), G148 (≠ T150), K174 (= K176), S176 (= S178), E177 (= E179), G207 (≠ K209), G211 (vs. gap), F225 (= F226), G228 (≠ S229), S231 (≠ I232), K234 (≠ Y235)
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8uzmA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G148 (≠ T150), W150 (≠ F152), K174 (= K176), S176 (= S178), E177 (= E179), G207 (≠ K209), G211 (vs. gap), F225 (= F226), T226 (≠ V227), G227 (= G228), G228 (≠ S229), S231 (≠ I232), E250 (≠ L250), G252 (= G252), C284 (= C284), E385 (= E385), F387 (= F387)
8uzkA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADP+ bound)
32% identity, 94% coverage: 10:480/500 of query aligns to 8:477/488 of 8uzkA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I147 (≠ V149), G148 (≠ T150), W150 (≠ F152), N151 (= N153), K174 (= K176), S176 (= S178), E177 (= E179), G207 (≠ K209), G211 (vs. gap), F225 (= F226), G227 (= G228), G228 (≠ S229), S231 (≠ I232), E250 (≠ L250), F387 (= F387)
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
32% identity, 94% coverage: 10:480/500 of query aligns to 9:478/489 of 4cazA
- active site: N152 (= N153), K175 (= K176), E251 (≠ L250), C285 (= C284), E386 (= E385), E463 (≠ H463)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (≠ V149), G149 (≠ T150), W151 (≠ F152), N152 (= N153), K175 (= K176), E178 (= E179), G208 (≠ K209), G212 (≠ D213), F226 (= F226), T227 (≠ V227), G228 (= G228), G229 (≠ S229), T232 (≠ I232), V236 (≠ I236), E251 (≠ L250), L252 (≠ G251), C285 (= C284), E386 (= E385), F388 (= F387)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
32% identity, 94% coverage: 10:480/500 of query aligns to 9:478/489 of 2woxA
- active site: N152 (= N153), K175 (= K176), E251 (≠ L250), C285 (= C284), E386 (= E385), E463 (≠ H463)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (≠ V149), G149 (≠ T150), W151 (≠ F152), N152 (= N153), K175 (= K176), S177 (= S178), E178 (= E179), G208 (≠ K209), G212 (≠ D213), F226 (= F226), T227 (≠ V227), G228 (= G228), G229 (≠ S229), T232 (≠ I232), V236 (≠ I236), E251 (≠ L250), L252 (≠ G251), C285 (= C284), E386 (= E385), F388 (= F387)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
32% identity, 94% coverage: 10:480/500 of query aligns to 9:478/489 of 2wmeA
- active site: N152 (= N153), K175 (= K176), E251 (≠ L250), C285 (= C284), E386 (= E385), E463 (≠ H463)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ T150), W151 (≠ F152), K175 (= K176), S177 (= S178), E178 (= E179), G208 (≠ K209), G212 (≠ D213), F226 (= F226), G228 (= G228), G229 (≠ S229), T232 (≠ I232), V236 (≠ I236)
8skfA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (lattice translocation disorder)
32% identity, 94% coverage: 10:480/500 of query aligns to 17:486/497 of 8skfA
- binding calcium ion: T33 (≠ V26), I34 (≠ F27), D100 (≠ E93), V187 (≠ R180)
- binding nicotinamide-adenine-dinucleotide: I156 (≠ V149), G157 (≠ T150), A158 (≠ P151), W159 (≠ F152), K183 (= K176), E186 (= E179), G216 (≠ K209), G220 (vs. gap), T235 (≠ V227), G236 (= G228), G237 (≠ S229), S240 (≠ I232), K243 (≠ Y235), E259 (≠ L250), C293 (= C284), F396 (= F387)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
32% identity, 94% coverage: 10:480/500 of query aligns to 10:479/490 of Q9HTJ1
- GAWN 150:153 (≠ TPFN 150:153) binding
- K162 (≠ M162) active site, Charge relay system
- KPSE 176:179 (= KPSE 176:179) binding
- G209 (≠ K209) binding
- GTST 230:233 (≠ STPI 229:232) binding
- E252 (≠ L250) active site, Proton acceptor
- C286 (= C284) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E385) binding
- E464 (≠ H463) active site, Charge relay system
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
34% identity, 94% coverage: 10:480/500 of query aligns to 9:477/489 of 6wsbA
- active site: N152 (= N153), E250 (≠ L250), C284 (= C284), E462 (≠ H463)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ V149), G149 (≠ T150), A150 (≠ P151), W151 (≠ F152), N152 (= N153), K175 (= K176), E178 (= E179), G208 (≠ K209), G211 (≠ V212), A212 (≠ D213), F225 (= F226), T226 (≠ V227), G227 (= G228), G228 (≠ S229), T231 (≠ I232), V235 (≠ I236), E250 (≠ L250), L251 (≠ G251), G252 (= G252), C284 (= C284), E385 (= E385), F387 (= F387)
Query Sequence
>AO353_21350 FitnessBrowser__pseudo3_N2E3:AO353_21350
MSDAKVIGHYLNGQVQDTGSERFSNVFNPATGAIQARVGLASQQTVDEAVASALRAFPAW
SEQSSLRRSRVMFKFKELLDRHHNELAEIISREHGKVFSDAKGEVTRGIEIVEYACGAPN
LLKTEFSDNIGGGIDNWNLRQPLGVCAGVTPFNFPVMVPLWMIPLALVTGNCFILKPSER
DPSASLLMARLLTEAGLPDGVFSVVQGDKSAVDALLQHPDIEAISFVGSTPIAEYIHQQA
TARGKRVQALGGAKNHMIVMPDADLDQAADALIGAAFGSAGERCMAISIAVAVGDVGDKL
IAKLLPRIDQLKVGNGMQGDSDMGPLVTAEHKAKVEGFIDQGVAQGAQLIVDGRGFKVPG
AENGFFVGATLFDKVTTEMSIYQQEIFGPVLGIVRVADFASAVALINAHEFGNGVSCFTS
DGGIARAFARTIKVGMVGINVPIPVPMAWHSFGGWKRSLFGDHHAYGEEGIRFYSRYKSV
MQRWPDSIAKGPEFSMPTAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory