Comparing AO353_21385 AO353_21385 D-ribose transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
49% identity, 94% coverage: 27:516/521 of query aligns to 4:493/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 42% coverage: 27:243/521 of query aligns to 2:214/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 42% coverage: 27:243/521 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 42% coverage: 27:243/521 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 42% coverage: 27:243/521 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 42% coverage: 27:243/521 of query aligns to 3:216/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 41% coverage: 32:243/521 of query aligns to 6:215/240 of 4ymuJ
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 42% coverage: 32:250/521 of query aligns to 9:236/254 of 1g6hA
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
30% identity, 41% coverage: 28:240/521 of query aligns to 4:214/350 of 3fvqB
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 42% coverage: 32:250/521 of query aligns to 9:236/253 of 1g9xB
3d31A Modbc from methanosarcina acetivorans (see paper)
29% identity, 43% coverage: 27:251/521 of query aligns to 1:215/348 of 3d31A
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
26% identity, 58% coverage: 28:329/521 of query aligns to 7:296/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 47% coverage: 28:272/521 of query aligns to 4:245/369 of P19566
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
28% identity, 47% coverage: 28:272/521 of query aligns to 1:242/367 of 1q12A
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
27% identity, 47% coverage: 28:272/521 of query aligns to 3:244/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
27% identity, 47% coverage: 28:272/521 of query aligns to 3:244/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
27% identity, 47% coverage: 28:272/521 of query aligns to 3:244/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
27% identity, 47% coverage: 28:272/521 of query aligns to 3:244/371 of 3puvA
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
27% identity, 47% coverage: 28:272/521 of query aligns to 4:245/371 of P68187
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
27% identity, 47% coverage: 28:272/521 of query aligns to 3:244/374 of 2awnB
>AO353_21385 AO353_21385 D-ribose transporter ATP-binding protein
MFASATASSIPLVGVQPNAIPVDEPYLLEIINVSKGFPGVVALSDVQLRVRPGSVLALMG
ENGAGKSTLMKIIAGIYQPDAGELRLRGKPVTFDTPLAALQAGIAMIHQELNLMPHMSIA
ENIWIGREQLNGFHMIDHREMHRCTAQLLERLRINLDPEEQVGNLSIAERQMVEIAKAVS
YDSDILIMDEPTSAITDKEVAHLFSIIADLKAQGKGIIYITHKMNEVFSIADEVAVFRDG
AYIGLQRADSMDGDSLISMMVGRELSQLFPVREKPIGDLLMSVRDLRLDGVFKGVSFDLH
AGEILGIAGLMGSGRTNVAEAIFGITPSDGGEICLDGQPVRISDPHMAIEKGFALLTEDR
KLSGLFPCLSVLENMEMAVLPHYAGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLS
GGNQQKALLARWLMTNPRILILDEPTRGIDVGAKAEIYRLISYLASEGMAVIMISSELPE
VLGMSDRVMVMHEGDLMGTLDRSEATQERVMQLASGMSVRH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory