Comparing AO353_21720 FitnessBrowser__pseudo3_N2E3:AO353_21720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
32% identity, 90% coverage: 20:216/220 of query aligns to 17:213/214 of 4ymwC
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
32% identity, 90% coverage: 20:216/220 of query aligns to 17:213/215 of 4ymtC
>AO353_21720 FitnessBrowser__pseudo3_N2E3:AO353_21720
MYESPSWLHELWVARDTLWSGFLTSVQCSVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRF
YVDLIRGTPVFVLVLACFYMAPALGWQIDAFQAGVLGLTLFCGSHVAEIVRGALQALPRG
QMEASKAIGLTFYQALAYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQ
IIARTFMTLEFYLFAGFLFFIINYAIELLGRHIEKRVALP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory