Comparing AO353_21740 FitnessBrowser__pseudo3_N2E3:AO353_21740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
29% identity, 91% coverage: 14:383/405 of query aligns to 8:347/373 of 4v15A
A1B8Z1 3-hydroxy-D-aspartate aldolase; beta-hydroxyaspartate aldolase; EC 4.1.3.41 from Paracoccus denitrificans (strain Pd 1222) (see paper)
26% identity, 90% coverage: 24:388/405 of query aligns to 26:368/387 of A1B8Z1
6qkbA Crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans (see paper)
26% identity, 90% coverage: 24:388/405 of query aligns to 23:365/384 of 6qkbA
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
27% identity, 75% coverage: 20:324/405 of query aligns to 16:309/398 of 7yqaB
Sites not aligning to the query:
3wqeA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 complexed with d-allothreonine (see paper)
30% identity, 37% coverage: 25:173/405 of query aligns to 7:153/379 of 3wqeA
Sites not aligning to the query:
3wqdA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 complexed with d-erythro-3-hydroxyaspartate (see paper)
30% identity, 37% coverage: 25:173/405 of query aligns to 7:153/379 of 3wqdA
Sites not aligning to the query:
3wqcA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 (see paper)
30% identity, 37% coverage: 25:173/405 of query aligns to 7:153/379 of 3wqcA
Sites not aligning to the query:
4pb5A D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with l- erythro-3-hydroxyaspartate (see paper)
30% identity, 36% coverage: 28:173/405 of query aligns to 10:153/379 of 4pb5A
Sites not aligning to the query:
4pb4A D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with 2- amino maleic acid (see paper)
30% identity, 36% coverage: 28:173/405 of query aligns to 10:153/379 of 4pb4A
Sites not aligning to the query:
B2DFG5 D-threo-3-hydroxyaspartate dehydratase; D-THA DH; D-THA dehydratase; Threo-3-hydroxy-D-aspartate ammonia-lyase; EC 4.3.1.27 from Delftia sp. (strain HT23) (see paper)
30% identity, 36% coverage: 28:173/405 of query aligns to 11:154/380 of B2DFG5
4pb3B D-threo-3-hydroxyaspartate dehydratase h351a mutant (see paper)
30% identity, 36% coverage: 28:173/405 of query aligns to 20:163/389 of 4pb3B
Sites not aligning to the query:
>AO353_21740 FitnessBrowser__pseudo3_N2E3:AO353_21740
MSSALNIAAVEKGAGQPGANLVRDVSLPALVLHREALEHNIHWMQAFVSHSGAELAPHGK
TSMTPSLFRRQLEAGAWGITLATVVQTRAAYAHGVRRVLMANQLVGAPNMALIAELLADP
SFDFYCMVDHPDNVADLGVFFAARGLRLNVMIEYGVVGGRCGCRSEAEVLALAEAIKAQP
GLALTGIEGYEGVIHGDQAVSGIREFAASLVRLAVQLQDSGAFAISKPIITASGSAWYDL
IAESFEAQNAGGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLHEGLRPALEVWAHVQ
SLPEPGFAVIALGKRDVAYDAGLPVPLLRYRAGVLPAVGDDVSACTVTAVMDQHAFMTVA
PGVQLRVGDIISFGTSHPCLTFDKWRTGCLVDEQLNVIESMETCF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory