Comparing AO353_22185 FitnessBrowser__pseudo3_N2E3:AO353_22185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
46% identity, 87% coverage: 27:262/271 of query aligns to 2:238/241 of 4qhqA
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
41% identity, 87% coverage: 27:263/271 of query aligns to 8:245/247 of 4ib2A
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
40% identity, 87% coverage: 27:263/271 of query aligns to 2:234/235 of 3tqwA
4yahX Crystal structure of the methionine binding protein, metq (see paper)
40% identity, 83% coverage: 37:262/271 of query aligns to 18:240/245 of 4yahX
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
34% identity, 83% coverage: 35:260/271 of query aligns to 13:235/240 of 1xs5A
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
37% identity, 84% coverage: 37:263/271 of query aligns to 47:270/272 of P04846
Sites not aligning to the query:
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
40% identity, 65% coverage: 50:226/271 of query aligns to 34:205/237 of 3k2dA
3gxaC Crystal structure of gna1946 (see paper)
34% identity, 81% coverage: 44:263/271 of query aligns to 18:236/244 of 3gxaC
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
34% identity, 87% coverage: 29:264/271 of query aligns to 8:239/240 of 4oteB
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
33% identity, 93% coverage: 11:263/271 of query aligns to 3:235/240 of 6dzxA
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
35% identity, 79% coverage: 50:264/271 of query aligns to 40:259/260 of 6jf1A
Sites not aligning to the query:
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
37% identity, 75% coverage: 64:267/271 of query aligns to 40:243/255 of 1p99A
Sites not aligning to the query:
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
32% identity, 78% coverage: 52:263/271 of query aligns to 31:240/242 of 4ntlA
Sites not aligning to the query:
>AO353_22185 FitnessBrowser__pseudo3_N2E3:AO353_22185
MFKQTGLTLAVLGGLVASFSALALEPLRVAADPVPHAQILAYVQKIDPQLNLKVIEIPNG
VNSNELLVHGDVDANYFQHLPYLKSQEQALGKKLEVAATVHIEPLGIYSHRHKSFAQVPQ
KGTVAVPNNVTNLSRALYLLQDNGLIKLKAGFNDPATDQATPKDIAENPKQLKILEIESP
QIPRALDDVDLAVINGNYALEAGLVPAKDALGLEKAEHNPYANILVTTPTLRDDPRIKQL
AKDLTSPQVTKFITDNFSGSVIPVTVADSKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory