SitesBLAST
Comparing AO353_22325 FitnessBrowser__pseudo3_N2E3:AO353_22325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
53% identity, 100% coverage: 1:248/249 of query aligns to 6:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (= S15), K21 (= K16), G22 (= G17), I23 (= I18), A43 (≠ T38), S44 (≠ R39), S45 (= S40), G68 (≠ A63), D69 (= D64), V70 (= V65), N96 (= N91), S97 (≠ A92), G98 (= G93), Y100 (= Y95), I144 (= I140), S146 (= S142), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (= G186), M191 (≠ L187), I192 (≠ V188), T194 (= T190), G196 (= G192), T197 (≠ V193)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S142), Y159 (= Y155), M191 (≠ L187), I202 (≠ F198)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
41% identity, 98% coverage: 7:249/249 of query aligns to 5:245/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
41% identity, 98% coverage: 7:249/249 of query aligns to 2:238/239 of 3sj7A
- active site: G12 (= G17), S138 (= S142), Q148 (≠ S152), Y151 (= Y155), K155 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (= S15), R11 (≠ K16), I13 (= I18), N31 (= N36), Y32 (= Y37), A33 (≠ T38), G34 (≠ R39), S35 (= S40), A58 (= A63), N59 (≠ D64), V60 (= V65), N86 (= N91), A87 (= A92), T109 (≠ L114), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
38% identity, 98% coverage: 3:247/249 of query aligns to 5:258/260 of 4fj2B
- active site: G19 (= G17), S143 (= S141), N144 (≠ S142), H154 (≠ S152), Y157 (= Y155), K161 (= K159), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), G19 (= G17), I20 (= I18), A40 (≠ T38), N41 (≠ R39), S42 (= S40), I67 (≠ V65), N93 (= N91), S94 (≠ A92), G95 (= G93), L116 (= L114), T141 (≠ N139), Y157 (= Y155), K161 (= K159), G188 (= G186), G189 (≠ L187), T190 (≠ V188), T192 (= T190), M194 (≠ G192)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ L187), F195 (≠ V193), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (≠ K206), A218 (≠ I207)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
38% identity, 98% coverage: 3:247/249 of query aligns to 5:258/260 of 3qwiA
- active site: G19 (= G17), S143 (= S141), N144 (≠ S142), H154 (≠ S152), Y157 (= Y155), K161 (= K159), Y202 (vs. gap)
- binding Coumestrol: F149 (= F147), G189 (≠ L187), M194 (≠ G192), Y202 (vs. gap), I203 (vs. gap), A218 (≠ I207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), A40 (≠ T38), N41 (≠ R39), S42 (= S40), I67 (≠ V65), N93 (= N91), S94 (≠ A92), G95 (= G93), L116 (= L114), T141 (≠ N139), Y157 (= Y155), K161 (= K159), P187 (= P185), G188 (= G186), G189 (≠ L187), T190 (≠ V188), T192 (= T190), M194 (≠ G192)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
38% identity, 98% coverage: 3:247/249 of query aligns to 5:258/260 of 3qwhA
- active site: G19 (= G17), S143 (= S141), N144 (≠ S142), H154 (≠ S152), Y157 (= Y155), K161 (= K159), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ S142), F149 (= F147), G189 (≠ L187), F195 (≠ V193), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), A218 (≠ I207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), G19 (= G17), I20 (= I18), A40 (≠ T38), N41 (≠ R39), S42 (= S40), D66 (= D64), I67 (≠ V65), N93 (= N91), S94 (≠ A92), G95 (= G93), L116 (= L114), T141 (≠ N139), Y157 (= Y155), K161 (= K159), P187 (= P185), G188 (= G186), G189 (≠ L187), T190 (≠ V188), T192 (= T190), M194 (≠ G192)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
38% identity, 98% coverage: 3:247/249 of query aligns to 6:259/261 of 4fj0D
- active site: G20 (= G17), S144 (= S141), N145 (≠ S142), H155 (≠ S152), Y158 (= Y155), K162 (= K159), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S141), N145 (≠ S142), G190 (≠ L187), F196 (≠ V193), S200 (vs. gap), Y203 (vs. gap), A219 (≠ I207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), R19 (≠ K16), G20 (= G17), I21 (= I18), A41 (≠ T38), N42 (≠ R39), S43 (= S40), I68 (≠ V65), N94 (= N91), S95 (≠ A92), G96 (= G93), L117 (= L114), T142 (≠ N139), Y158 (= Y155), K162 (= K159), P188 (= P185), G189 (= G186), G190 (≠ L187), T191 (≠ V188), T193 (= T190), M195 (≠ G192)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
38% identity, 98% coverage: 3:247/249 of query aligns to 4:257/259 of 4fj1B
- active site: G18 (= G17), S142 (= S141), N143 (≠ S142), H153 (≠ S152), Y156 (= Y155), K160 (= K159), Y201 (vs. gap)
- binding genistein: G188 (≠ L187), F194 (≠ V193), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (≠ K206), A217 (≠ I207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), R17 (≠ K16), G18 (= G17), I19 (= I18), A39 (≠ T38), N40 (≠ R39), S41 (= S40), I66 (≠ V65), N92 (= N91), S93 (≠ A92), G94 (= G93), L115 (= L114), T140 (≠ N139), S142 (= S141), Y156 (= Y155), K160 (= K159), G187 (= G186), T189 (≠ V188), T191 (= T190), M193 (≠ G192)
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
40% identity, 98% coverage: 3:247/249 of query aligns to 9:262/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S141), Y161 (= Y155), G193 (≠ L187), M198 (≠ G192), F199 (≠ V193), V202 (≠ S196), S203 (≠ G197), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G13), R22 (≠ K16), G23 (= G17), I24 (= I18), Y43 (= Y37), A44 (≠ T38), N45 (≠ R39), S46 (= S40), D70 (= D64), V71 (= V65), N97 (= N91), S98 (≠ A92), L120 (= L114), T145 (≠ N139), S147 (= S141), Y161 (= Y155), K165 (= K159), P191 (= P185), G192 (= G186), T194 (≠ V188), T196 (= T190), M198 (≠ G192)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
41% identity, 98% coverage: 3:247/249 of query aligns to 5:257/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S142), N144 (≠ S143), T145 (≠ V144), F153 (≠ S152), Y156 (= Y155), G187 (= G186), M193 (≠ G192), V197 (≠ S196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), A40 (≠ T38), N41 (≠ R39), S42 (= S40), D66 (= D64), N93 (= N91), S94 (≠ A92), L116 (= L114), T141 (≠ I140), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (= G186), G188 (≠ L187), T189 (≠ V188), T191 (= T190), M193 (≠ G192)
Sites not aligning to the query:
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
40% identity, 98% coverage: 3:247/249 of query aligns to 5:258/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ S142), T145 (≠ S143), F154 (≠ S152), G189 (≠ L187), V198 (≠ S196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), Y39 (= Y37), A40 (≠ T38), N41 (≠ R39), S42 (= S40), D66 (= D64), V67 (= V65), N93 (= N91), S94 (≠ A92), L116 (= L114), T141 (≠ N139), Y157 (= Y155), K161 (= K159), P187 (= P185), T190 (≠ V188), T192 (= T190), M194 (≠ G192)
Sites not aligning to the query:
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
41% identity, 97% coverage: 6:247/249 of query aligns to 4:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (= S15), R14 (≠ K16), G15 (= G17), I16 (= I18), L36 (≠ T38), R37 (= R39), N38 (≠ S40), A61 (= A63), D62 (= D64), V63 (= V65), N89 (= N91), A90 (= A92), G91 (= G93), T113 (≠ L114), V143 (≠ I140), S145 (= S142), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (= G186), I192 (≠ V188), T194 (= T190), I196 (≠ V193), H197 (= H194)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 98% coverage: 4:248/249 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G17), S142 (= S142), Q152 (≠ S152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ K16), G16 (= G17), I17 (= I18), N35 (= N36), Y36 (= Y37), N37 (≠ T38), G38 (≠ R39), S39 (= S40), N63 (≠ D64), V64 (= V65), N90 (= N91), A91 (= A92), I93 (≠ V94), I113 (≠ L114), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ V188), T190 (= T190)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
40% identity, 97% coverage: 7:247/249 of query aligns to 3:247/248 of 4iqgD
- active site: G13 (= G17), N112 (= N115), S143 (= S142), Y154 (≠ S152), Y157 (= Y155), K161 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G13), S11 (= S15), R12 (≠ K16), G13 (= G17), I14 (= I18), N32 (= N36), A34 (≠ T38), S35 (≠ R39), N36 (≠ S40), A59 (= A63), D60 (= D64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), V141 (≠ I140), S143 (= S142), Y157 (= Y155), K161 (= K159), P187 (= P185), G188 (= G186), I190 (≠ V188), T192 (= T190), I194 (≠ V193), H195 (= H194)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
38% identity, 98% coverage: 5:249/249 of query aligns to 4:242/244 of 6wprA
- active site: G16 (= G17), S138 (= S142), Y151 (= Y155)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ K16), T37 (= T38), L58 (≠ A63), D59 (= D64), V60 (= V65), N86 (= N91), A87 (= A92), G88 (= G93), I89 (≠ V94), I136 (= I140), Y151 (= Y155), K155 (= K159), P181 (= P185)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
38% identity, 98% coverage: 5:249/249 of query aligns to 4:242/244 of 6t62A
- active site: G16 (= G17), S138 (= S142), Y151 (= Y155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ K16), A36 (≠ Y37), T37 (= T38), L58 (≠ A63), D59 (= D64), V60 (= V65), N86 (= N91), A87 (= A92), G88 (= G93), I89 (≠ V94), I136 (= I140), S137 (= S141), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), I184 (≠ V188), M188 (≠ G192)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
37% identity, 98% coverage: 4:247/249 of query aligns to 5:252/255 of 3iccA
- active site: G18 (= G17), S148 (= S142), F158 (≠ S152), Y161 (= Y155), K165 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), S16 (= S15), R17 (≠ K16), G18 (= G17), I19 (= I18), H37 (≠ N36), Y38 (= Y37), G39 (≠ T38), L66 (≠ V65), E67 (≠ S66), N98 (= N91), G100 (= G93), I146 (= I140), S148 (= S142), Y161 (= Y155), K165 (= K159), P191 (= P185), G192 (= G186), M198 (≠ V193), N199 (≠ H194)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
39% identity, 98% coverage: 4:248/249 of query aligns to 3:243/245 of 5wuwA
- active site: G16 (= G17), S140 (= S142), Y154 (= Y155), L161 (≠ V162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), R15 (≠ K16), I17 (= I18), Y36 (= Y37), A37 (≠ T38), A38 (≠ R39), D63 (= D64), S64 (≠ V65), N90 (= N91), A91 (= A92), G92 (= G93), Y154 (= Y155), K158 (= K159), G185 (= G186), P186 (≠ L187), V187 (= V188)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
35% identity, 99% coverage: 2:248/249 of query aligns to 3:250/261 of P40288
- 11:35 (vs. 10:34, 40% identical) binding
- E96 (≠ Y95) mutation E->A,G,K: Heat stable.
- D108 (≠ E107) mutation to N: Heat stable.
- V112 (≠ Q111) mutation to A: Heat stable.
- E133 (vs. gap) mutation to K: Heat stable.
- V183 (= V180) mutation to I: Heat stable.
- P194 (≠ E191) mutation to Q: Heat stable.
- E210 (= E208) mutation to K: Heat stable.
- Y217 (≠ R215) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
35% identity, 99% coverage: 2:248/249 of query aligns to 3:250/261 of 1g6kA
- active site: G18 (= G17), S145 (= S142), Y158 (= Y155), K162 (= K159)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ K16), G18 (= G17), L19 (≠ I18), R39 (≠ T38), D65 (= D64), V66 (= V65), N92 (= N91), A93 (= A92), G94 (= G93), M143 (≠ I140), S145 (= S142), Y158 (= Y155), P188 (= P185), G189 (= G186), I191 (≠ V188), T193 (= T190)
Query Sequence
>AO353_22325 FitnessBrowser__pseudo3_N2E3:AO353_22325
MKKLHRKIALVTGSSKGIGAAIARQLAKDGATVIVNYTRSREDADRVVSQILETGARAYA
IRADVSNALEVKALFKAIVHEHGHIDILVNNAGVYATGALAEITEQEFNRQFNLNVLGLI
QCTQEAVAVFNPKGGSIINISSSVTSFTPANSTVYTASKGAVDAITKTLANELGPKNIRV
NSVNPGLVVTEGVHASGFFEDAFRQKIEAITPLGRIGSPEDIAPAVAFLASDDAGWITGE
ILVIGGGLH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory