Comparing AO353_22845 FitnessBrowser__pseudo3_N2E3:AO353_22845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
70% identity, 94% coverage: 6:168/173 of query aligns to 2:165/165 of 2vi7C
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
44% identity, 62% coverage: 58:164/173 of query aligns to 55:160/164 of 2ge3A
Sites not aligning to the query:
3wr7A Crystal structure of spermidine acetyltransferase from escherichia coli (see paper)
27% identity, 83% coverage: 21:164/173 of query aligns to 16:159/170 of 3wr7A
P0A951 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Escherichia coli (strain K12) (see 4 papers)
27% identity, 83% coverage: 21:164/173 of query aligns to 20:163/186 of P0A951
Sites not aligning to the query:
4r9mA Crystal structure of spermidine n-acetyltransferase from escherichia coli (see paper)
26% identity, 84% coverage: 19:164/173 of query aligns to 15:160/169 of 4r9mA
8q6uB Crystal structure of a double mutant acetyltransferase from bacillus cereus species. (see paper)
36% identity, 60% coverage: 46:149/173 of query aligns to 44:143/166 of 8q6uB
6e1xC Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
26% identity, 96% coverage: 2:167/173 of query aligns to 2:168/176 of 6e1xC
6cx8A Crystal structure of spermidine/spermine n-acetyltransferase speg from vibrio cholerae in complex with manganese ions.
28% identity, 85% coverage: 21:167/173 of query aligns to 18:165/173 of 6cx8A
Q9KL03 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see 2 papers)
28% identity, 85% coverage: 21:167/173 of query aligns to 18:165/173 of Q9KL03
6e1xA Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
28% identity, 85% coverage: 21:167/173 of query aligns to 17:164/170 of 6e1xA
5cnpB X-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae. (see paper)
28% identity, 85% coverage: 21:167/173 of query aligns to 17:164/171 of 5cnpB
4r87A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine (see paper)
28% identity, 85% coverage: 21:167/173 of query aligns to 17:164/170 of 4r87A
4r57A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa (see paper)
28% identity, 85% coverage: 21:167/173 of query aligns to 17:164/170 of 4r57A
4nczA Spermidine n-acetyltransferase from vibrio cholerae in complex with 2- [n-cyclohexylamino]ethane sulfonate. (see paper)
28% identity, 85% coverage: 21:167/173 of query aligns to 17:164/170 of 4nczA
4mi4A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine (see paper)
28% identity, 85% coverage: 21:167/173 of query aligns to 17:164/170 of 4mi4A
4mhdA Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine (see paper)
28% identity, 85% coverage: 21:167/173 of query aligns to 17:164/170 of 4mhdA
6yzzA Arabidopsis thaliana naa50 in complex with accoa (see paper)
37% identity, 38% coverage: 89:153/173 of query aligns to 75:138/151 of 6yzzA
6z00A Arabidopsis thaliana naa50 in complex with bisubstrate analogue coa- ac-mvnal (see paper)
38% identity, 37% coverage: 89:152/173 of query aligns to 80:142/156 of 6z00A
Sites not aligning to the query:
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
27% identity, 73% coverage: 40:166/173 of query aligns to 44:170/171 of 2i79A
Sites not aligning to the query:
6d72B Crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis in complex with calcium ions.
26% identity, 72% coverage: 21:145/173 of query aligns to 21:145/176 of 6d72B
>AO353_22845 FitnessBrowser__pseudo3_N2E3:AO353_22845
MSAIDPVISIERMSEAHIEGITALYNDPAVARQVLQMPFQSTEVWRKRLAPENERVVQLV
ALHQGQVIGNVGLEQVSRIRRSHCANIGMGVAVAWQGKGVGSRLLAAVLDLADNWMNVQR
VELSVYADNEAAIGLYRKFGFDTEGLFREYAVRDGVLVDALSMARLRRLLKAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory