SitesBLAST
Comparing AO353_23170 FitnessBrowser__pseudo3_N2E3:AO353_23170 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
40% identity, 96% coverage: 8:252/254 of query aligns to 4:245/247 of 3rwbA
- active site: G17 (= G21), S140 (= S148), Y153 (= Y161), K157 (= K165)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S148), N141 (≠ D149), T142 (= T150), M150 (≠ L158), Y153 (= Y161), L185 (= L193), H196 (≠ E204)
- binding nicotinamide-adenine-dinucleotide: G13 (= G17), Q16 (≠ R20), G17 (= G21), I18 (≠ L22), D37 (= D41), I38 (= I42), D60 (= D67), I61 (≠ L68), N87 (= N94), A88 (= A95), S89 (= S96), I138 (≠ L146), S140 (= S148), Y153 (= Y161), K157 (= K165), P183 (= P191), L185 (= L193), I186 (≠ V194), S188 (≠ V196), G190 (≠ A198), V191 (≠ T199)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
40% identity, 96% coverage: 8:252/254 of query aligns to 4:245/247 of 3ndrA
- active site: G17 (= G21), S140 (= S148), Y153 (= Y161), K157 (= K165)
- binding nicotinamide-adenine-dinucleotide: G13 (= G17), Q16 (≠ R20), G17 (= G21), I18 (≠ L22), D37 (= D41), I38 (= I42), D60 (= D67), I61 (≠ L68), N87 (= N94), A88 (= A95), S89 (= S96), V110 (= V119), I138 (≠ L146), S140 (= S148), Y153 (= Y161), K157 (= K165), P183 (= P191), L185 (= L193), I186 (≠ V194), S188 (≠ V196), G190 (≠ A198), V191 (≠ T199)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 96% coverage: 8:251/254 of query aligns to 3:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), Q15 (≠ R20), G16 (= G21), I17 (≠ L22), D36 (= D41), V63 (≠ L68), N89 (= N94), A91 (≠ S96), S94 (≠ N99), I142 (≠ L146), S143 (≠ A147), S144 (= S148), Y157 (= Y161), K161 (= K165), P187 (= P191), H188 (≠ G192), I190 (≠ V194), I194 (vs. gap)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
39% identity, 97% coverage: 4:250/254 of query aligns to 2:247/251 of 6d9yB
- active site: G20 (= G21), S145 (= S148), Y158 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G16 (= G17), R19 (= R20), G20 (= G21), D40 (= D41), L41 (≠ I42), V64 (= V66), D65 (= D67), Q66 (≠ L68), A93 (= A95), S145 (= S148), Y158 (= Y161), K162 (= K165), P188 (= P191), A189 (≠ G192), A190 (≠ L193), A191 (≠ V194), T193 (≠ V196)
2zatA Crystal structure of a mammalian reductase (see paper)
37% identity, 96% coverage: 8:250/254 of query aligns to 3:246/251 of 2zatA
- active site: G16 (= G21), S142 (= S148), L152 (= L158), Y155 (= Y161), K159 (= K165), K200 (≠ E204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G17), T14 (≠ A19), D15 (≠ R20), G16 (= G21), I17 (≠ L22), S36 (≠ D41), R37 (≠ I42), K38 (≠ L43), N41 (≠ R46), H62 (≠ D67), N89 (= N94), A91 (≠ S96), V140 (≠ L146), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), G186 (= G192), I188 (≠ V194), T190 (≠ V196), F192 (≠ A198), S193 (≠ T199)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
37% identity, 96% coverage: 8:250/254 of query aligns to 31:274/279 of Q8WNV7
- 37:61 (vs. 14:38, 48% identical) binding
- F177 (≠ A155) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (= L158) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y161) active site, Proton acceptor
- K187 (= K165) binding
- N196 (≠ S174) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 97% coverage: 8:253/254 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G21), S142 (= S148), Q152 (≠ L158), Y155 (= Y161), K159 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (= R20), G16 (= G21), I17 (≠ L22), N35 (≠ A40), Y36 (≠ D41), N37 (≠ I42), G38 (≠ L43), S39 (≠ A44), N63 (≠ D67), V64 (≠ L68), N90 (= N94), A91 (= A95), I93 (= I97), I113 (≠ V119), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), I188 (≠ V194), T190 (≠ V196)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
38% identity, 98% coverage: 4:252/254 of query aligns to 1:247/249 of Q5P5I4
- M1 (≠ L4) modified: Initiator methionine, Removed
- NGI 17:19 (≠ RGL 20:22) binding
- D38 (= D41) binding
- CDV 61:63 (≠ VDL 66:68) binding
- N89 (= N94) binding
- Y93 (≠ T98) binding
- K158 (= K165) binding
- PSLV 184:187 (≠ PGLV 191:194) binding
- T191 (≠ L195) binding
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
38% identity, 96% coverage: 8:252/254 of query aligns to 3:245/247 of 2ewmB
- active site: G16 (= G21), S139 (= S148), Y149 (≠ L158), Y152 (= Y161), K156 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), N15 (≠ R20), G16 (= G21), I17 (≠ L22), D36 (= D41), L37 (≠ I42), C59 (≠ V66), D60 (= D67), V61 (≠ L68), N87 (= N94), S139 (= S148), Y152 (= Y161), K156 (= K165), P182 (= P191), S183 (≠ G192), L184 (= L193), V185 (= V194), T189 (≠ L195)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
37% identity, 96% coverage: 8:250/254 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ R20) binding
- D36 (= D41) binding
- D62 (= D67) binding
- I63 (≠ L68) binding
- N89 (= N94) binding
- Y153 (= Y161) binding
- K157 (= K165) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
37% identity, 96% coverage: 8:250/254 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), M16 (≠ L22), D35 (= D41), I36 (= I42), I62 (≠ L68), N88 (= N94), G90 (≠ S96), I138 (≠ L146), S140 (= S148), Y152 (= Y161), K156 (= K165), I185 (≠ V194)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
34% identity, 96% coverage: 8:250/254 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G21), S145 (= S148), F155 (≠ L158), Y158 (= Y161), K162 (= K165), K203 (≠ E204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G17), T17 (≠ A19), D18 (≠ R20), G19 (= G21), I20 (≠ L22), S39 (≠ D41), R40 (≠ I42), K41 (≠ L43), N44 (≠ R46), H65 (≠ D67), V66 (≠ L68), N92 (= N94), A94 (≠ S96), S145 (= S148), Y158 (= Y161), K162 (= K165), P188 (= P191), G189 (= G192), L190 (= L193), I191 (≠ V194), T193 (≠ V196), F195 (≠ A198), S196 (≠ T199)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
34% identity, 96% coverage: 8:250/254 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ A155) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ L158) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ S174) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
38% identity, 97% coverage: 8:253/254 of query aligns to 5:257/258 of 3ak4A
- active site: G18 (= G21), S141 (= S148), L151 (= L158), Y154 (= Y161), K158 (= K165), E199 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ R20), G18 (= G21), I19 (≠ L22), D38 (= D41), L39 (≠ I42), V60 (vs. gap), D61 (= D67), V62 (≠ L68), N88 (= N94), A89 (= A95), G90 (≠ S96), T139 (≠ L146), S141 (= S148), Y154 (= Y161), K158 (= K165), G185 (= G192), V187 (= V194), T189 (≠ V196), M191 (vs. gap)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
35% identity, 96% coverage: 8:251/254 of query aligns to 4:249/252 of 1vl8B
- active site: G17 (= G21), S143 (= S148), I154 (≠ L158), Y157 (= Y161), K161 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G17), R16 (= R20), G17 (= G21), L18 (= L22), S37 (≠ D41), R38 (≠ I42), C63 (≠ V66), D64 (= D67), V65 (≠ L68), A91 (≠ N94), A92 (= A95), G93 (≠ S96), I94 (= I97), V114 (= V119), I141 (≠ L146), S143 (= S148), Y157 (= Y161), K161 (= K165), P187 (= P191), G188 (= G192), Y190 (≠ V194), T192 (≠ V196), M194 (≠ A198), T195 (= T199)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
37% identity, 96% coverage: 6:250/254 of query aligns to 2:253/257 of 6pejA
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
41% identity, 96% coverage: 7:251/254 of query aligns to 2:236/240 of 2d1yA
- active site: G16 (= G21), S135 (= S148), N145 (≠ L158), Y148 (= Y161), K152 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), R15 (= R20), I17 (≠ L22), D36 (= D41), L37 (≠ I42), R38 (≠ L43), V55 (= V66), D56 (= D67), L57 (= L68), N83 (= N94), A84 (= A95), A85 (≠ S96), I86 (= I97), V133 (≠ L146), S135 (= S148), Y148 (= Y161), K152 (= K165), P178 (= P191), G179 (= G192), I181 (≠ V194), T183 (≠ V196), A185 (= A198), V186 (= V202)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
38% identity, 97% coverage: 8:254/254 of query aligns to 7:252/259 of 6ci9D
- active site: G20 (= G21), S145 (= S148), Y159 (= Y161)
- binding 1-aminopropan-2-one: F97 (≠ T98), S145 (= S148), T147 (= T150), W156 (≠ L158), Y159 (= Y161), G190 (= G192)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G17), S18 (≠ A19), G20 (= G21), I21 (≠ L22), G40 (≠ D41), R41 (≠ I42), N42 (≠ L43), D66 (= D67), V67 (≠ L68), N93 (= N94), G95 (≠ S96), T143 (≠ L146), S145 (= S148), Y159 (= Y161), K163 (= K165), P189 (= P191), N191 (≠ L193), I192 (≠ V194), T194 (≠ V196), G196 (≠ A198), L197 (≠ T199)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
34% identity, 96% coverage: 9:253/254 of query aligns to 4:243/244 of 6wprA
- active site: G16 (= G21), S138 (= S148), Y151 (= Y161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (= R20), T37 (≠ I39), L58 (≠ V66), D59 (= D67), V60 (≠ L68), N86 (= N94), A87 (= A95), G88 (≠ S96), I89 (= I97), I136 (≠ L146), Y151 (= Y161), K155 (= K165), P181 (= P191)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
34% identity, 96% coverage: 9:253/254 of query aligns to 4:243/244 of 6t62A
- active site: G16 (= G21), S138 (= S148), Y151 (= Y161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (= R20), A36 (vs. gap), T37 (≠ I39), L58 (≠ V66), D59 (= D67), V60 (≠ L68), N86 (= N94), A87 (= A95), G88 (≠ S96), I89 (= I97), I136 (≠ L146), S137 (≠ A147), S138 (= S148), Y151 (= Y161), K155 (= K165), P181 (= P191), G182 (= G192), I184 (≠ V194), M188 (≠ A198)
Query Sequence
>AO353_23170 FitnessBrowser__pseudo3_N2E3:AO353_23170
MTTLNRLLEGRRVLVTGGARGLGYAFAQAIGRAGAHVVIADILAERVQQSAAELVAEGLT
VHGVAVDLAQPDSIDTCVAETTRLLGGLDGLVNNASITNSGGKTCEELSLDTWDQVMHVN
VRGTWLMTKACLPALRASGHGAIVNLASDTPLWGAPNLLAYVASKGAIIAMTRSLARELG
TDNITVNAIAPGLVLVEATAYVPEARHRLYNEQRAIQRPQLPEDVSGAVLFALSDLARFI
TGQTLPVNGGFVMP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory