SitesBLAST
Comparing AO353_23185 FitnessBrowser__pseudo3_N2E3:AO353_23185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 73% coverage: 36:237/278 of query aligns to 35:243/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
38% identity, 73% coverage: 36:237/278 of query aligns to 35:243/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
38% identity, 73% coverage: 36:237/278 of query aligns to 35:243/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ P40), S61 (= S62), G62 (= G63), G64 (= G65), K65 (= K66), S66 (= S67), T67 (= T68), Q111 (= Q103), K161 (≠ F153), Q162 (= Q154), S164 (= S156), G166 (= G158), M167 (= M159), Q188 (≠ E180), H221 (= H213)
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
35% identity, 76% coverage: 21:230/278 of query aligns to 2:209/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F31), S38 (= S62), C40 (= C64), G41 (= G65), K42 (= K66), S43 (= S67), T44 (= T68), Q82 (= Q103), R129 (≠ H150), Q133 (= Q154), S135 (= S156), G136 (= G157), G137 (= G158), Q159 (≠ E180), H192 (= H213)
- binding magnesium ion: S43 (= S67), Q82 (= Q103)
8hprC Lpqy-sugabc in state 4 (see paper)
35% identity, 76% coverage: 21:230/278 of query aligns to 2:209/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F31), S38 (= S62), G39 (= G63), G41 (= G65), K42 (= K66), S43 (= S67), Q82 (= Q103), Q133 (= Q154), G136 (= G157), G137 (= G158), Q138 (≠ M159), H192 (= H213)
- binding magnesium ion: S43 (= S67), Q82 (= Q103)
8hplC Lpqy-sugabc in state 1 (see paper)
35% identity, 76% coverage: 21:230/278 of query aligns to 2:207/384 of 8hplC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 79% coverage: 22:240/278 of query aligns to 18:231/378 of P69874
- C26 (= C30) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F31) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ V55) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C64) mutation to T: Loss of ATPase activity and transport.
- L60 (= L70) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V86) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ C142) mutation to M: Loss of ATPase activity and transport.
- D172 (= D179) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 75% coverage: 21:228/278 of query aligns to 3:208/393 of P9WQI3
- H193 (= H213) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
1g291 Malk (see paper)
32% identity, 68% coverage: 42:229/278 of query aligns to 18:214/372 of 1g291
- binding magnesium ion: D69 (≠ G93), E71 (≠ V95), K72 (vs. gap), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S62), G39 (= G63), C40 (= C64), G41 (= G65), K42 (= K66), T43 (≠ S67), T44 (= T68)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
36% identity, 67% coverage: 44:230/278 of query aligns to 20:209/371 of P68187
- A85 (≠ L106) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (= K130) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A135) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L138) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D140) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q145) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G158) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D179) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 67% coverage: 44:230/278 of query aligns to 19:208/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S62), G38 (= G63), C39 (= C64), G40 (= G65), K41 (= K66), S42 (= S67), T43 (= T68), Q81 (= Q103), R128 (≠ H150), A132 (≠ Q154), S134 (= S156), G136 (= G158), Q137 (≠ M159), E158 (= E180), H191 (= H213)
- binding magnesium ion: S42 (= S67), Q81 (= Q103)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 67% coverage: 44:230/278 of query aligns to 19:208/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G63), C39 (= C64), G40 (= G65), K41 (= K66), S42 (= S67), T43 (= T68), R128 (≠ H150), S134 (= S156), Q137 (≠ M159)
- binding beryllium trifluoride ion: S37 (= S62), G38 (= G63), K41 (= K66), Q81 (= Q103), S134 (= S156), G136 (= G158), H191 (= H213)
- binding magnesium ion: S42 (= S67), Q81 (= Q103)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
36% identity, 67% coverage: 44:230/278 of query aligns to 19:208/371 of 3puwA
- binding adenosine-5'-diphosphate: G38 (= G63), C39 (= C64), G40 (= G65), K41 (= K66), S42 (= S67), T43 (= T68), R128 (≠ H150), A132 (≠ Q154), S134 (= S156), Q137 (≠ M159)
- binding tetrafluoroaluminate ion: S37 (= S62), G38 (= G63), K41 (= K66), Q81 (= Q103), S134 (= S156), G135 (= G157), G136 (= G158), E158 (= E180), H191 (= H213)
- binding magnesium ion: S42 (= S67), Q81 (= Q103)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
36% identity, 67% coverage: 44:230/278 of query aligns to 19:208/371 of 3puvA
- binding adenosine-5'-diphosphate: G38 (= G63), C39 (= C64), G40 (= G65), K41 (= K66), S42 (= S67), T43 (= T68), R128 (≠ H150), A132 (≠ Q154), S134 (= S156), Q137 (≠ M159)
- binding magnesium ion: S42 (= S67), Q81 (= Q103)
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 67% coverage: 44:230/278 of query aligns to 19:208/374 of 2awnB
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
36% identity, 67% coverage: 44:230/278 of query aligns to 17:206/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S62), G36 (= G63), C37 (= C64), G38 (= G65), K39 (= K66), S40 (= S67), T41 (= T68), R126 (≠ H150), A130 (≠ Q154), S132 (= S156), G134 (= G158), Q135 (≠ M159)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 68% coverage: 42:229/278 of query aligns to 21:217/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 75% coverage: 22:230/278 of query aligns to 4:209/369 of P19566
- L86 (= L107) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P181) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D186) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
37% identity, 70% coverage: 22:215/278 of query aligns to 2:206/232 of 1f3oA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
35% identity, 77% coverage: 22:235/278 of query aligns to 4:220/226 of 5xu1B
Query Sequence
>AO353_23185 FitnessBrowser__pseudo3_N2E3:AO353_23185
MYAIAPQWNKPAPKEDQEPTEIEFRNVGKCFPAKGKSEAPFAIREVNFKIRRGEVVSIIG
PSGCGKSTILNMGSGLYRPTEGEVFVAGEAVTGPVRQVAFMLQKDLLMPWRSIRRNVELG
LEIQGVPAAKRQAVAKDLLDRCHLQGFADHYPFQLSGGMRQRAALARTLAIDPQVLFLDE
PFSALDAQTKMILQQDMARMLFDEKKTALFITHDLIEAIAMSDRLLVMSARPGTIIEEIT
VDLPFRDNPLERRKLPEIGPLVGRLMELLQVGEDTELH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory