Comparing AO353_23195 FitnessBrowser__pseudo3_N2E3:AO353_23195 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
Q81RQ4 3-dehydroshikimate dehydratase; 3-DHS dehydratase; DHSase; Petrobactin biosynthesis protein AsbF; EC 4.2.1.118 from Bacillus anthracis (see paper)
23% identity, 38% coverage: 146:261/307 of query aligns to 122:236/280 of Q81RQ4
Sites not aligning to the query:
3dx5A Crystal structure of the probable 3-dhs dehydratase asbf involved in the petrobactin synthesis from bacillus anthracis (see paper)
23% identity, 38% coverage: 146:261/307 of query aligns to 122:236/274 of 3dx5A
Sites not aligning to the query:
>AO353_23195 FitnessBrowser__pseudo3_N2E3:AO353_23195
MTLHISTAPCCWGVDDVNNPHLPAWQQVLSEAAQAGYRGIELGPYGYLPLDAAAVGTVLA
EQGLHVVAGTVFDNLVDPANLPNVLTQTRNICALLKQLPAVPQEPGQRFAMPCLVVIDWG
HEERDYAAGHSERAPRLAPDAWRGMMNHIRAIADLAWLEFGVRTVIHPHAGGYIEFADEL
AQLVADIPYEVAGLCLDTGHLYYAGMDPVQTLRQYADRLDYLHFKDIDQAVFDQVLGEHI
SFFGACARGVMCPIGQGVIDYRALRELITELGYQGYITVEQERDPRNARGSLRDVAASRA
YLSQAGF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory