Comparing AO353_23295 FitnessBrowser__pseudo3_N2E3:AO353_23295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
83% identity, 98% coverage: 7:392/392 of query aligns to 1:374/377 of 7ba4A
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
66% identity, 96% coverage: 12:389/392 of query aligns to 3:380/384 of 4iyoD
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
66% identity, 96% coverage: 12:389/392 of query aligns to 3:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
66% identity, 96% coverage: 12:389/392 of query aligns to 3:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
66% identity, 96% coverage: 12:389/392 of query aligns to 3:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
66% identity, 96% coverage: 12:389/392 of query aligns to 3:380/381 of 4ixzA
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
66% identity, 96% coverage: 12:389/392 of query aligns to 4:381/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
66% identity, 96% coverage: 12:389/392 of query aligns to 4:381/382 of 6k1lA
4ixsB Native structure of xometc at ph 5.2 (see paper)
65% identity, 96% coverage: 12:389/392 of query aligns to 2:371/372 of 4ixsB
6cjaA Crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine
61% identity, 96% coverage: 13:389/392 of query aligns to 4:380/381 of 6cjaA
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
53% identity, 96% coverage: 15:392/392 of query aligns to 5:373/373 of 4l0oH
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
52% identity, 96% coverage: 15:390/392 of query aligns to 5:377/377 of 7d7oB
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
51% identity, 96% coverage: 13:389/392 of query aligns to 9:385/390 of 8j6nA
6le4A Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with cystathionine (see paper)
51% identity, 97% coverage: 13:392/392 of query aligns to 3:378/380 of 6le4A
6ldoA Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with l-serine (see paper)
51% identity, 97% coverage: 13:392/392 of query aligns to 3:378/381 of 6ldoA
5x5hA Crystal structure of metb from corynebacterium glutamicum (see paper)
49% identity, 97% coverage: 11:392/392 of query aligns to 6:384/385 of 5x5hA
7mcyH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl3 (see paper)
49% identity, 96% coverage: 15:389/392 of query aligns to 5:377/380 of 7mcyH
Sites not aligning to the query:
7mcuH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl2 (see paper)
49% identity, 96% coverage: 15:389/392 of query aligns to 5:377/380 of 7mcuH
Sites not aligning to the query:
7mctH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl1 (see paper)
49% identity, 96% coverage: 15:389/392 of query aligns to 5:377/380 of 7mctH
Sites not aligning to the query:
7mcqA Crystal structure of staphylococcus aureus cystathionine gamma lyase, aoaa-bound enzyme in dimeric form (see paper)
49% identity, 96% coverage: 15:389/392 of query aligns to 5:377/380 of 7mcqA
>AO353_23295 FitnessBrowser__pseudo3_N2E3:AO353_23295
MSQHDENATPRAFATRVIHAGQTPDPTTGALMPPIYANSTYLQQSPGVHKGFDYGRSHNP
TRFALERCVADLEGGTQAFAFASGLAAISTVLELLDTGSHIVSGNDLYGGTFRLFDKVRR
RSAGHRFSFVDLTDLTAFEAALQDDTRMVWVETPSNPLLRITDLAAVARTCRERGIICVA
DNTFASPRIQRPLELGFDIVLHSTTKYLNGHSDVIGGIAVVGQNAELRERLGFLQNAVGA
IAGPFDAFLTLRGVKTLALRMERHCSNALELARWLSHQPQVARVYYPGLPSHPQHELAQR
QMHGFGGMISLDLDTDLAGAKRFLESVQIFALAESLGGVESLIEHPAIMTHASIPAETRA
ELGIGDALIRLSVGIEDVEDLRADLAQALAQI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory