SitesBLAST
Comparing AO353_23435 FitnessBrowser__pseudo3_N2E3:AO353_23435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 95% coverage: 38:722/722 of query aligns to 7:723/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M69), G39 (= G70), Q40 (= Q71), H41 (≠ G72), V42 (≠ I73), A45 (≠ G76), G79 (= G116), G80 (= G117), S81 (= S118), S83 (= S120), V84 (≠ T121), G374 (= G397), F375 (= F398), L379 (≠ A402), L499 (≠ M519), R500 (= R520), V624 (= V623), D625 (≠ N624), Q632 (= Q631), T687 (≠ G686), G688 (= G687), L689 (≠ I688), G690 (= G689), E691 (= E690)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 49% coverage: 199:550/722 of query aligns to 7:374/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
33% identity, 19% coverage: 584:718/722 of query aligns to 604:746/761 of 1rm6A
- active site: E718 (= E690), G719 (≠ T691)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ V623), N647 (= N624), V651 (≠ I628), Q654 (= Q631), K714 (vs. gap), E715 (vs. gap), A716 (vs. gap), S717 (vs. gap), E718 (= E690)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
33% identity, 19% coverage: 584:717/722 of query aligns to 612:753/769 of O33819
- VGKALN 650:655 (≠ CGVVVN 619:624) binding
- KEAS 722:725 (vs. gap) binding
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 49% coverage: 197:550/722 of query aligns to 16:380/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
27% identity, 49% coverage: 197:550/722 of query aligns to 16:380/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
22% identity, 49% coverage: 197:551/722 of query aligns to 12:402/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 49% coverage: 194:550/722 of query aligns to 2:380/420 of 3hrdE
- active site: Q207 (= Q367), L242 (≠ A402), R318 (≠ K480), H322 (≠ D484), R350 (= R520)
- binding calcium ion: T206 (= T366), N208 (≠ F368), D212 (= D372), K241 (≠ R401), L242 (≠ A402), D243 (≠ N403)
- binding pterin cytosine dinucleotide: G237 (= G397), F238 (= F398), R350 (= R520)
- binding selenium atom: F238 (= F398), A348 (≠ W518), F349 (≠ M519), R350 (= R520)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 49% coverage: 194:550/722 of query aligns to 2:380/420 of 3hrdA
- active site: Q207 (= Q367), L242 (≠ A402), R318 (≠ K480), H322 (≠ D484), R350 (= R520)
- binding pterin cytosine dinucleotide: G236 (= G396), G237 (= G397), F238 (= F398), R350 (= R520)
- binding magnesium ion: T206 (= T366), N208 (≠ F368), D212 (= D372), K241 (≠ R401), L242 (≠ A402), D243 (≠ N403), T305 (≠ S467), Y308 (≠ D470), A309 (≠ G471), S346 (≠ T512)
- binding nicotinic acid: A314 (= A476), R318 (≠ K480), F352 (≠ V522)
- binding selenium atom: F238 (= F398), G239 (= G399), A348 (≠ W518), F349 (≠ M519), R350 (= R520)
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
28% identity, 18% coverage: 590:717/722 of query aligns to 183:316/330 of 3hrdB
- active site: E289 (= E690), P290 (≠ T691)
- binding pterin cytosine dinucleotide: I215 (≠ V623), N216 (= N624), M219 (≠ S627), V220 (≠ I628), Q223 (= Q631), K285 (vs. gap), G286 (= G687), V287 (≠ I688), G288 (= G689), E289 (= E690)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
28% identity, 18% coverage: 590:717/722 of query aligns to 183:316/330 of Q0QLF1
- 211:223 (vs. 619:631, 23% identical) binding
- AKGVGE 284:289 (≠ --GIGE 687:690) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
23% identity, 73% coverage: 185:714/722 of query aligns to 527:1065/1291 of 2e3tA
- active site: Q740 (= Q367), E775 (≠ A402), R853 (≠ G471), H857 (≠ E475), R885 (= R520)
- binding bicarbonate ion: R812 (= R439), H813 (≠ S440), I850 (= I468), T882 (≠ L517), A883 (≠ W518), F887 (≠ V522), G888 (= G523), Q891 (≠ H526)
- binding calcium ion: E713 (≠ A342), H714 (= H343), Y716 (≠ P345), T809 (≠ R434), G810 (= G435), G840 (= G465), T843 (vs. gap), E844 (vs. gap), S847 (vs. gap), S880 (= S515), N881 (≠ V516)
- binding fe2/s2 (inorganic) cluster: L717 (≠ M346)
- binding uric acid: E775 (≠ A402), R853 (≠ G471), F887 (≠ V522), F982 (= F638), T983 (≠ G639), A1051 (≠ V700), A1052 (= A701)
Sites not aligning to the query:
- active site: 1233, 1234
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 1234
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
23% identity, 73% coverage: 185:714/722 of query aligns to 527:1065/1295 of 6a7xA
- active site: Q740 (= Q367), E775 (≠ A402), R853 (≠ G471), H857 (≠ E475), R885 (= R520)
- binding bicarbonate ion: R812 (= R439), H813 (≠ S440), I850 (= I468), A883 (≠ W518), F884 (≠ M519), F887 (≠ V522), G888 (= G523), Q891 (≠ H526)
- binding uric acid: E775 (≠ A402), R853 (≠ G471), F887 (≠ V522), F982 (= F638), T983 (≠ G639), A1052 (= A701)
Sites not aligning to the query:
- active site: 1233, 1234
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 1234
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
23% identity, 73% coverage: 185:714/722 of query aligns to 525:1063/1286 of 4yswA
- active site: Q738 (= Q367), E773 (≠ A402), R851 (≠ G471), H855 (≠ E475), R883 (= R520)
- binding bicarbonate ion: R810 (= R439), H811 (≠ S440), I848 (= I468), T880 (≠ L517), A881 (≠ W518), F882 (≠ M519), F885 (≠ V522), G886 (= G523), Q889 (≠ H526)
- binding calcium ion: G838 (= G465), T841 (vs. gap), E842 (vs. gap), S845 (vs. gap), S878 (= S515), N879 (≠ V516)
- binding fe2/s2 (inorganic) cluster: L715 (≠ M346)
- binding uric acid: E773 (≠ A402), R851 (≠ G471), F885 (≠ V522), F980 (= F638), T981 (≠ G639), A1050 (= A701)
Sites not aligning to the query:
- active site: 1231, 1232
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 1232
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
23% identity, 73% coverage: 185:714/722 of query aligns to 525:1063/1291 of 6a7xB
- active site: Q738 (= Q367), E773 (≠ A402), R851 (≠ G471), H855 (≠ E475), R883 (= R520)
- binding bicarbonate ion: R810 (= R439), H811 (≠ S440), T880 (≠ L517), A881 (≠ W518), F885 (≠ V522), G886 (= G523), Q889 (≠ H526)
- binding fe2/s2 (inorganic) cluster: L715 (≠ M346)
- binding uric acid: E773 (≠ A402), R851 (≠ G471), F885 (≠ V522), F980 (= F638), T981 (≠ G639), A1049 (≠ V700), A1050 (= A701)
Sites not aligning to the query:
- active site: 1231, 1232
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 1232
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 73% coverage: 185:714/722 of query aligns to 554:1092/1331 of P22985
- C992 (= C615) mutation to R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
23% identity, 50% coverage: 188:550/722 of query aligns to 165:563/907 of 4usaA
- active site: I390 (≠ Q367), F425 (≠ A402), R501 (≠ V483), F505 (≠ S487), R533 (= R520)
- binding bicarbonate ion: R460 (= R439), A531 (vs. gap), F532 (≠ M519), Y535 (≠ V522), Q539 (≠ H526)
- binding hydrocinnamic acid: I255 (vs. gap), F425 (≠ A402), F494 (≠ A476), L497 (≠ V479), Y535 (≠ V522)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G397), F421 (= F398), G422 (= G399), R533 (= R520)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding hydrocinnamic acid: 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
23% identity, 50% coverage: 188:550/722 of query aligns to 165:563/907 of 4us9A
- active site: I390 (≠ Q367), F425 (≠ A402), R501 (≠ V483), F505 (≠ S487), R533 (= R520)
- binding 3-phenylpropanal: I255 (vs. gap), F257 (vs. gap), P258 (vs. gap)
- binding bicarbonate ion: R460 (= R439), L498 (≠ K480), A531 (vs. gap), F532 (≠ M519), Y535 (≠ V522), Q539 (≠ H526)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G397), F421 (= F398), G422 (= G399), R533 (= R520)
Sites not aligning to the query:
- active site: 869, 870
- binding 3-phenylpropanal: 752
- binding bicarbonate ion: 890, 892
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
23% identity, 50% coverage: 188:550/722 of query aligns to 165:563/907 of 4us8A
- active site: I390 (≠ Q367), F425 (≠ A402), R501 (≠ V483), F505 (≠ S487), R533 (= R520)
- binding bicarbonate ion: R460 (= R439), L498 (≠ K480), A531 (vs. gap), F532 (≠ M519), Y535 (≠ V522), Q539 (≠ H526)
- binding benzaldehyde: I255 (vs. gap), I255 (vs. gap), L394 (= L371), F425 (≠ A402), F425 (≠ A402), F425 (≠ A402), F425 (≠ A402), L497 (≠ V479), L497 (≠ V479), R501 (≠ V483), A531 (vs. gap), Y535 (≠ V522), Y535 (≠ V522)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G397), F421 (= F398), G422 (= G399), R533 (= R520)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding benzaldehyde: 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
23% identity, 50% coverage: 188:550/722 of query aligns to 165:563/907 of 4c7yA
- active site: I390 (≠ Q367), F425 (≠ A402), R501 (≠ V483), F505 (≠ S487), R533 (= R520)
- binding bicarbonate ion: R460 (= R439), L498 (≠ K480), A531 (vs. gap), Y535 (≠ V522), Q539 (≠ H526)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G397), F421 (= F398), G422 (= G399), R533 (= R520)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
Query Sequence
>AO353_23435 FitnessBrowser__pseudo3_N2E3:AO353_23435
MNAKIETSRRDFLKSTAVLGAGLVVAFVIPGANRFAQAASTPDAVFAPNAFLRIAPDGSV
TILLGHSEMGQGIWTGLTMLIAEELDADWTKIRVEHAPASAADYGLPAFGGMQITGGSTS
TWMEFDRYRQAGAAARLMLIEAAAKRFNVAPSKIQTEPGVVIAGDQRATYGELANDAGQL
PVPDPASIKLKDAKDWKIIGKPTKRLDTPEKITGQAKFGMDVQFDGLLTAVVARPPVFGG
SVKSFDGAAALALPGVHKVVQVPTGIAVVADHYWAAKLGRDALKIDWDLGPNAGLDSDAL
LQNFRKLAAIPGTPASQAGDISAALSKAVKTIDVEYSVPYLAHAPMEPLNCTVKITPDKC
EIWTGTQFQTLDQMIAAKITGLKPEQVEIHTEFLGGGFGRRANPTSDFVSEAVQVAKAAV
APVKTVWSREDDIRGGYYRSAFLHHARIGLDAKGMPQAWQHVLVGQSIMDGTPFEATMVK
NGVDATSVEGVADSPYIKGLANHLVDLHSPKTGISVLWMRSVGHTHTAFVVESLIDELAT
AAGKDPVEYRRTLLKEHPRHLGVLNLAVEKANWKAPLPAGHALGVAVHESFGSYVAQVAE
VSQDNLKIRVHRVVCAVDCGVVVNPASIAAQMESGITFGLGFTLHSKLTFKDGKVVQSNY
HDFQVLRLNEMPVVEVHIVPSTEKPGGIGETGVPPTAPAVANAVFALTGQRLRELPLQLA
GV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory