Comparing AO353_23520 FitnessBrowser__pseudo3_N2E3:AO353_23520 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
3zo7B Crystal structure of clcfe27a with substrate (see paper)
50% identity, 98% coverage: 1:94/96 of query aligns to 1:94/94 of 3zo7B
>AO353_23520 FitnessBrowser__pseudo3_N2E3:AO353_23520
MLFHVKMTVNLPVDMDPERAARLKSDEKALAQRLQQQGKWRHLWRIAGLYANYSVFDVDS
VQELHDLLMQLPLYPYMAIEVNAMCRHPSSIHEDDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory