SitesBLAST
Comparing AO353_23780 FitnessBrowser__pseudo3_N2E3:AO353_23780 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 83% coverage: 23:286/317 of query aligns to 16:280/304 of 1wwkA
- active site: S96 (≠ Y104), R230 (= R236), D254 (= D260), E259 (= E265), H278 (= H284)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ A108), G146 (= G152), F147 (≠ L153), G148 (= G154), R149 (≠ S155), I150 (= I156), Y168 (≠ W174), D169 (≠ S175), P170 (≠ E176), V201 (≠ L207), P202 (≠ V208), T207 (≠ S213), T228 (= T234), S229 (≠ A235), D254 (= D260), H278 (= H284), G280 (= G286)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
33% identity, 74% coverage: 52:286/317 of query aligns to 49:290/334 of 5aovA
- active site: L100 (≠ Y104), R241 (= R236), D265 (= D260), E270 (= E265), H288 (= H284)
- binding glyoxylic acid: M52 (≠ V55), L53 (≠ M56), L53 (≠ M56), Y74 (≠ G79), A75 (≠ G80), V76 (≠ M81), G77 (≠ R82), R241 (= R236), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ M81), T104 (≠ A108), F158 (≠ L153), G159 (= G154), R160 (≠ S155), I161 (= I156), S180 (= S175), R181 (≠ E176), A211 (≠ H206), V212 (≠ L207), P213 (≠ V208), T218 (≠ S213), I239 (≠ T234), A240 (= A235), R241 (= R236), H288 (= H284), G290 (= G286)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
35% identity, 73% coverage: 55:286/317 of query aligns to 46:279/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
35% identity, 73% coverage: 55:286/317 of query aligns to 47:280/525 of 3ddnB
Sites not aligning to the query:
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
30% identity, 84% coverage: 45:310/317 of query aligns to 38:320/334 of 3kb6B
- active site: S97 (≠ K105), R231 (= R236), D255 (= D260), E260 (= E265), H294 (= H284)
- binding lactic acid: F49 (≠ M56), S72 (≠ G80), V73 (≠ M81), G74 (≠ R82), Y96 (= Y104), R231 (= R236), H294 (= H284)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ M81), Y96 (= Y104), V101 (≠ A108), G150 (= G154), R151 (≠ S155), I152 (= I156), D171 (≠ E176), V172 (≠ N177), P203 (≠ V208), T229 (= T234), A230 (= A235), R231 (= R236), H294 (= H284), A296 (≠ G286), Y297 (= Y287)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 75% coverage: 55:291/317 of query aligns to 44:282/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G154), I148 (= I156), Y166 (≠ W174), D167 (≠ S175), P168 (≠ E176), I169 (≠ N177), I170 (≠ L178), H198 (= H206), T199 (≠ L207), L208 (= L216), R228 (= R236)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
34% identity, 75% coverage: 55:291/317 of query aligns to 47:285/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
34% identity, 75% coverage: 55:291/317 of query aligns to 46:284/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ K105), A100 (= A108), R149 (≠ S155), I150 (= I156), Y168 (≠ W174), D169 (≠ S175), P170 (≠ E176), I171 (≠ N177), H200 (= H206), T201 (≠ L207), P202 (≠ V208), T207 (≠ S213), C228 (≠ T234), A229 (= A235), R230 (= R236), H277 (= H284), G279 (= G286)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
34% identity, 75% coverage: 55:291/317 of query aligns to 47:285/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (= L151), G147 (= G152), L148 (= L153), G149 (= G154), R150 (≠ S155), I151 (= I156), G152 (= G157), D170 (≠ S175), H201 (= H206), T202 (≠ L207), P203 (≠ V208)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
34% identity, 75% coverage: 55:291/317 of query aligns to 47:285/302 of 6rihA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 77% coverage: 47:291/317 of query aligns to 41:286/305 of 6plfA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
34% identity, 75% coverage: 55:291/317 of query aligns to 46:284/297 of 6rj3A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
34% identity, 75% coverage: 55:291/317 of query aligns to 47:285/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
34% identity, 75% coverage: 55:291/317 of query aligns to 48:286/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ M81), A102 (= A108), G148 (= G152), R151 (≠ S155), I152 (= I156), Y170 (≠ W174), D171 (≠ S175), P172 (≠ E176), I173 (≠ N177), H202 (= H206), T203 (≠ L207), P204 (≠ V208), T209 (≠ S213), C230 (≠ T234), A231 (= A235), R232 (= R236), H279 (= H284), G281 (= G286)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
34% identity, 75% coverage: 55:291/317 of query aligns to 52:290/533 of O43175
- T78 (≠ M81) binding
- R135 (≠ Q137) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ SI 155:156) binding
- D175 (≠ S175) binding
- T207 (≠ L207) binding
- CAR 234:236 (≠ TAR 234:236) binding
- D260 (= D260) binding
- V261 (= V261) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVGY 284:287) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 69% coverage: 72:291/317 of query aligns to 55:276/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ S155), Y160 (≠ W174), D161 (≠ S175), P162 (≠ E176), I164 (≠ L178), L179 (≠ K193), T193 (≠ L207), P194 (≠ V208), S198 (≠ R212), L202 (= L216)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
33% identity, 83% coverage: 48:310/317 of query aligns to 50:328/336 of 5z20F
- active site: S108 (≠ K105), R241 (= R236), D265 (= D260), E270 (= E265), H302 (= H284)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y104), G160 (= G154), Q161 (≠ S155), I162 (= I156), Y180 (≠ W174), D181 (≠ E176), P182 (≠ N177), C212 (≠ L207), P213 (≠ V208), T218 (≠ S213), T239 (= T234), G240 (≠ A235), R241 (= R236), H302 (= H284), A304 (≠ G286)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
35% identity, 72% coverage: 58:286/317 of query aligns to 57:289/332 of 6biiA
- active site: L99 (≠ Y104), R240 (= R236), D264 (= D260), E269 (= E265), H287 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ M81), T103 (≠ A108), G156 (= G152), F157 (≠ L153), G158 (= G154), R159 (≠ S155), I160 (= I156), A179 (≠ S175), R180 (≠ E176), S181 (≠ N177), K183 (≠ T179), V211 (≠ L207), P212 (≠ V208), E216 (≠ R212), T217 (≠ S213), V238 (≠ T234), A239 (= A235), R240 (= R236), D264 (= D260), H287 (= H284), G289 (= G286)
7cvpA The crystal structure of human phgdh from biortus.
36% identity, 58% coverage: 107:291/317 of query aligns to 54:239/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G152), G103 (= G154), R104 (≠ S155), I105 (= I156), Y123 (≠ W174), D124 (≠ S175), P125 (≠ E176), I126 (≠ N177), H155 (= H206), T156 (≠ L207), P157 (≠ V208), T162 (≠ S213), C183 (≠ T234), A184 (= A235), R185 (= R236), H232 (= H284), G234 (= G286)
4u6sA Ctbp1 in complex with substrate phenylpyruvate (see paper)
33% identity, 77% coverage: 67:310/317 of query aligns to 61:316/328 of 4u6sA
- active site: S99 (≠ K105), R241 (= R236), D265 (= D260), E270 (= E265), H290 (= H284)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ A108), G156 (= G152), G158 (= G154), R159 (≠ S155), V160 (≠ I156), Y178 (≠ W174), D179 (≠ S175), P180 (≠ E176), Y181 (≠ N177), H211 (= H206), C212 (≠ L207), G213 (≠ V208), N218 (≠ S213), T239 (= T234), A240 (= A235), R241 (= R236), H290 (= H284), W293 (≠ Y287)
- binding 3-phenylpyruvic acid: I73 (≠ G79), G74 (= G80), S75 (≠ M81), G76 (≠ R82), R241 (= R236), W293 (≠ Y287), M302 (≠ F296)
Sites not aligning to the query:
Query Sequence
>AO353_23780 FitnessBrowser__pseudo3_N2E3:AO353_23780
MTVQIAVIDDWQGVARHVVDWSVLDGIGKVSFLHDYPADHPTLSDRLQSFEVICVMRERT
LFDEALLRNLPKLKLLVTGGMRNAAIDLKAAAALGIQVCGTDSYKQAAPELTWTLIMALT
RNLLAEANALRAGHWQQGLGGDLYGKTLGILGLGSIGKRIAEFGQVFGMRVIAWSENLTA
ERAAEAGVTFVSKRELFEQADVLSIHLVLSERSRGLVDEQALGWMKPSALLINTARGPIV
DEAALIQALEQNRLKGAALDVFEREPLAADHPFRTLPNVLATPHVGYVSEQNYRLFFSQM
IEDIQAWTTGHSIRLLN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory