SitesBLAST
Comparing AO353_24045 FitnessBrowser__pseudo3_N2E3:AO353_24045 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 89% coverage: 14:245/260 of query aligns to 24:257/265 of P07821
- K50 (= K40) mutation to Q: Lack of activity.
- D172 (= D160) mutation to E: Lack of activity.
- E173 (= E161) mutation to A: Lack of activity.
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 88% coverage: 1:228/260 of query aligns to 1:228/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y11), V16 (= V16), S36 (≠ N36), G37 (= G37), S38 (≠ A38), G39 (= G39), K40 (= K40), S41 (≠ T41), T42 (= T42), E162 (= E161), H194 (= H194)
- binding magnesium ion: S41 (≠ T41), E162 (= E161)
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
33% identity, 83% coverage: 1:217/260 of query aligns to 1:226/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
32% identity, 83% coverage: 1:217/260 of query aligns to 1:226/230 of 1l2tA
- binding adenosine-5'-triphosphate: Y11 (= Y11), S40 (≠ N36), G41 (= G37), S42 (≠ A38), G43 (= G39), K44 (= K40), S45 (≠ T41), T46 (= T42), F138 (≠ Y132), Q145 (≠ E135), S147 (= S137), G149 (= G139), Q150 (= Q140), H204 (= H194)
5x40A Structure of a cbio dimer bound with amppcp (see paper)
31% identity, 93% coverage: 7:248/260 of query aligns to 11:258/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: F14 (≠ A10), V18 (≠ R14), A20 (≠ V16), N40 (= N36), G41 (= G37), G43 (= G39), K44 (= K40), S45 (≠ T41), T46 (= T42), Q88 (= Q82), H139 (≠ D134), M140 (≠ E135), L141 (= L136), S142 (= S137), G144 (= G139), Q145 (= Q140), Q166 (≠ E161), H198 (= H194)
- binding magnesium ion: S45 (≠ T41), Q88 (= Q82)
1g291 Malk (see paper)
34% identity, 85% coverage: 2:223/260 of query aligns to 4:227/372 of 1g291
- binding magnesium ion: D69 (= D67), E71 (vs. gap), K72 (vs. gap), K79 (≠ R71), D80 (= D72)
- binding pyrophosphate 2-: S38 (≠ N36), G39 (= G37), C40 (≠ A38), G41 (= G39), K42 (= K40), T43 (= T41), T44 (= T42)
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
34% identity, 83% coverage: 2:218/260 of query aligns to 3:215/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
34% identity, 83% coverage: 2:218/260 of query aligns to 1:213/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y11), S35 (≠ N36), G36 (= G37), C37 (≠ A38), G38 (= G39), K39 (= K40), S40 (≠ T41), T41 (= T42), R126 (≠ S131), A130 (≠ E135), S132 (= S137), G134 (= G139), Q135 (= Q140)
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
34% identity, 83% coverage: 2:218/260 of query aligns to 3:215/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y11), S37 (≠ N36), G38 (= G37), C39 (≠ A38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), Q81 (= Q82), R128 (≠ S131), A132 (≠ E135), S134 (= S137), G136 (= G139), Q137 (= Q140), E158 (= E161), H191 (= H194)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q82)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
34% identity, 83% coverage: 2:218/260 of query aligns to 3:215/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), G38 (= G37), C39 (≠ A38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (≠ S131), S134 (= S137), Q137 (= Q140)
- binding beryllium trifluoride ion: S37 (≠ N36), G38 (= G37), K41 (= K40), Q81 (= Q82), S134 (= S137), G136 (= G139), H191 (= H194)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q82)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
34% identity, 83% coverage: 2:218/260 of query aligns to 3:215/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), V17 (= V16), G38 (= G37), C39 (≠ A38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (≠ S131), A132 (≠ E135), S134 (= S137), Q137 (= Q140)
- binding tetrafluoroaluminate ion: S37 (≠ N36), G38 (= G37), K41 (= K40), Q81 (= Q82), S134 (= S137), G135 (= G138), G136 (= G139), E158 (= E161), H191 (= H194)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q82)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
34% identity, 83% coverage: 2:218/260 of query aligns to 3:215/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), V17 (= V16), G38 (= G37), C39 (≠ A38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (≠ S131), A132 (≠ E135), S134 (= S137), Q137 (= Q140)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q82)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
34% identity, 83% coverage: 2:218/260 of query aligns to 4:216/371 of P68187
- A85 (≠ D85) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ L108) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ I116) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A119) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E121) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q126) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G139) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D160) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 85% coverage: 2:223/260 of query aligns to 7:230/375 of 2d62A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 87% coverage: 1:225/260 of query aligns to 2:225/241 of 4u00A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 83% coverage: 2:218/260 of query aligns to 4:216/369 of P19566
- L86 (≠ F86) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P162) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D167) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 85% coverage: 2:223/260 of query aligns to 7:216/353 of 1vciA
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
34% identity, 81% coverage: 4:214/260 of query aligns to 6:216/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (≠ Y11), Q14 (≠ G12), T16 (≠ R14), V18 (= V16), S38 (≠ N36), G39 (= G37), C40 (≠ A38), G41 (= G39), K42 (= K40), T43 (= T41), T44 (= T42), R133 (≠ S131), E137 (= E135), S139 (= S137), G141 (= G139), Q142 (= Q140)
- binding calcium ion: T43 (= T41), Q86 (= Q82)
8hplC Lpqy-sugabc in state 1 (see paper)
32% identity, 83% coverage: 2:218/260 of query aligns to 3:214/384 of 8hplC
8hprC Lpqy-sugabc in state 4 (see paper)
32% identity, 83% coverage: 2:218/260 of query aligns to 3:216/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y11), S38 (≠ N36), G39 (= G37), G41 (= G39), K42 (= K40), S43 (≠ T41), Q82 (= Q82), Q133 (≠ E135), G136 (= G138), G137 (= G139), Q138 (= Q140), H192 (= H194)
- binding magnesium ion: S43 (≠ T41), Q82 (= Q82)
Query Sequence
>AO353_24045 FitnessBrowser__pseudo3_N2E3:AO353_24045
MIALNHVYKAYGTRHVLSDVSVRFPPGQVTSLIGPNGAGKTTLLMLIARLLAPTRGDVLI
GGRSILDVPVRDYAKRVATLRQSPDFNLRLTVEELVAFGRFPYSRGALTAQDREAIDEAI
EFLSLQSLRLSYIDELSGGQRQMAFLAMTIAQQTDYLLLDEPLNNLDMKHGVQIMRALRR
LCDEQGRTVILVVHDINFAANYSDHIVAMKGGGIHRHGPVAEVVTEAHLRELFDLDFEIL
QSEQGFVCNYFNPSPSRELI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory