Comparing AO353_24305 FitnessBrowser__pseudo3_N2E3:AO353_24305 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
59% identity, 98% coverage: 2:277/281 of query aligns to 7:278/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
59% identity, 98% coverage: 2:277/281 of query aligns to 7:278/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
42% identity, 77% coverage: 64:280/281 of query aligns to 63:278/279 of 6v77B
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
38% identity, 99% coverage: 1:277/281 of query aligns to 2:274/277 of 6iymA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
40% identity, 77% coverage: 61:277/281 of query aligns to 82:301/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
41% identity, 74% coverage: 71:277/281 of query aligns to 92:300/303 of 8skyB
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
34% identity, 88% coverage: 30:277/281 of query aligns to 16:260/265 of 3r6oA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
36% identity, 81% coverage: 50:278/281 of query aligns to 47:277/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
36% identity, 81% coverage: 50:278/281 of query aligns to 47:277/280 of 6j5xA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
35% identity, 74% coverage: 71:277/281 of query aligns to 12:213/216 of 6sbiA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
36% identity, 74% coverage: 71:277/281 of query aligns to 18:219/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
36% identity, 74% coverage: 71:277/281 of query aligns to 13:214/218 of 6fogA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
38% identity, 76% coverage: 66:278/281 of query aligns to 49:248/252 of 3qdfA
1gttA Crystal structure of hpce (see paper)
41% identity, 62% coverage: 73:247/281 of query aligns to 225:392/421 of 1gttA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
35% identity, 85% coverage: 43:280/281 of query aligns to 25:269/269 of 4dbhA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
35% identity, 85% coverage: 41:278/281 of query aligns to 54:261/264 of 6jvwB
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
34% identity, 74% coverage: 70:278/281 of query aligns to 23:231/233 of 6j5yA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
32% identity, 63% coverage: 72:247/281 of query aligns to 17:197/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
29% identity, 69% coverage: 71:264/281 of query aligns to 9:219/247 of 1nkqA
3bqbX Hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase (see paper)
28% identity, 53% coverage: 122:271/281 of query aligns to 138:280/291 of 3bqbX
>AO353_24305 FitnessBrowser__pseudo3_N2E3:AO353_24305
MKLCRFGPPGKERPGLLDTDGRIRDLSAHVTDIDASVLAPAALAELSKLDVAGLPVVEEG
VRYGVPVAQVRKFIAIGLNYRDHAEEAGMAIPTEPIIFHKAISCLSGPDDDIVQPPHSTK
LDWELELGVVIGSEAQYVSEANALDYVAGYCVVNDVSERAFQMQSSQWDKGKGCDTFGPI
GPWLVTRDEVADPQNLDMWLDVNGERRQIGNSKTMIFSVAQIVSYCSRYMTLQPGDVICT
GTPPGVGMGMKPEPQWLHPGDQIHLWIDGLGEQRQKVVPAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory