Comparing AO353_24430 FitnessBrowser__pseudo3_N2E3:AO353_24430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
21% identity, 55% coverage: 37:273/434 of query aligns to 40:269/857 of Q63342
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
21% identity, 55% coverage: 37:273/434 of query aligns to 3:232/824 of 4pabB
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
28% identity, 50% coverage: 41:258/434 of query aligns to 3:211/363 of 7cyxA
Sites not aligning to the query:
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 24% coverage: 30:132/434 of query aligns to 62:161/629 of Q9SS48
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
21% identity, 62% coverage: 19:286/434 of query aligns to 28:289/866 of Q9UI17
Sites not aligning to the query:
>AO353_24430 FitnessBrowser__pseudo3_N2E3:AO353_24430
MFNGDRPFISGQESEINHSMWSATGGEKPESVVLARQESCDVLIIGGGFNGVTAGLHCAE
RGARTILVEAQEIGSGASGRNAGQVNPGQFLSPEQILRALGPDYGQLFLKELGSAPDVVR
QLIRDYGIDCAADERPIIRCSTSPQKTRELEIQASDWQALGANVQMVYGSELEEMNGSIR
YKAALIDHRGFTLQPLAYVRGLARAAVARGLRISTGSKVTSLEPSGTGWVATTGNTTIKA
DKVILSTNAYSNDLVPGFKEEIMPLGAFGIATADPLPPEWRERILPHYIAMWDTHKIPLW
FRYDPVGRLHVGSIGFLPIHSEGDNWVNRAMKFVYPFAPTFKWGYRWSGTLGQTVDRLPH
LVEPRPGIFATIGCNGRGIAPNAYFGKMLAKIALGDDVITPLPLRTSSKYPMREIALEAY
DAGIRFYRNTLLFT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory