SitesBLAST
Comparing AO353_24770 FitnessBrowser__pseudo3_N2E3:AO353_24770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 82% coverage: 35:390/436 of query aligns to 24:364/383 of 5i39A
- active site: F66 (≠ N77), Q69 (= Q80), A70 (≠ L81), Q248 (vs. gap), P267 (≠ C287)
- binding flavin-adenine dinucleotide: V30 (≠ I41), G31 (= G42), G33 (= G44), I34 (≠ F45), L35 (≠ T46), V53 (≠ L64), E54 (= E65), K55 (≠ G66), Q62 (≠ A73), S63 (= S74), F66 (≠ N77), Y67 (≠ G78), Q69 (= Q80), A196 (≠ P215), A197 (≠ V216), G226 (vs. gap), G227 (= G242), W229 (≠ N244), Q248 (vs. gap), Q250 (≠ S263), G321 (= G346), M323 (≠ I348), T348 (≠ S374), G349 (= G375), W350 (≠ H376), G351 (= G377), M352 (≠ L378), T353 (≠ N379)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
24% identity, 79% coverage: 53:398/436 of query aligns to 22:357/374 of 1y56B
- active site: F44 (≠ G75), G47 (= G78), T48 (≠ G79), H224 (≠ A273), P239 (≠ L284), G305 (= G346), M338 (≠ N379)
- binding flavin-adenine dinucleotide: I33 (≠ L64), E34 (= E65), K35 (≠ G66), S42 (≠ A73), T43 (≠ S74), R45 (= R76), C46 (≠ N77), G47 (= G78), G49 (= G84), E170 (≠ P215), V171 (= V216), T200 (≠ C243), N201 (= N244), W203 (≠ H246), G305 (= G346), Y306 (≠ R347), Y307 (≠ I348), G334 (= G375), H335 (= H376), G336 (= G377), F337 (≠ L378), M338 (≠ N379)
- binding flavin mononucleotide: F44 (≠ G75), R45 (= R76), I260 (≠ L304), R301 (≠ Y342), W303 (= W344)
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
27% identity, 47% coverage: 35:240/436 of query aligns to 5:201/824 of 4pabB
- active site: T53 (≠ G84), E102 (≠ A144)
- binding flavin-adenine dinucleotide: I11 (= I41), G12 (= G42), G14 (= G44), C15 (≠ F45), V16 (≠ T46), L35 (= L64), E36 (= E65), K37 (≠ G66), G43 (= G72), S44 (≠ A73), T45 (≠ S74), H47 (≠ R76), A48 (≠ N77), A49 (≠ G78), G50 (= G79), L51 (≠ I82), V175 (= V216)
Sites not aligning to the query:
- active site: 226, 255, 536
- binding flavin-adenine dinucleotide: 204, 205, 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
26% identity, 49% coverage: 26:240/436 of query aligns to 36:245/866 of Q9UI17
- CV 59:60 (≠ FT 45:46) binding
- EK 80:81 (≠ EG 65:66) binding
- 87:95 (vs. 72:82, 18% identical) binding
- H91 (≠ R76) modified: Tele-8alpha-FAD histidine
- H109 (≠ G97) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V216) binding
Sites not aligning to the query:
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 47% coverage: 35:240/436 of query aligns to 42:238/857 of Q63342
- CV 52:53 (≠ FT 45:46) binding
- EK 73:74 (≠ EG 65:66) binding
- 80:88 (vs. 72:82, 18% identical) binding
- H84 (≠ R76) modified: Tele-8alpha-FAD histidine
- V212 (= V216) binding
Sites not aligning to the query:
- 244 binding
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
24% identity, 48% coverage: 35:242/436 of query aligns to 16:217/433 of 5hxwA
- active site: F58 (≠ N77), Q61 (= Q80), A62 (≠ L81)
- binding flavin-adenine dinucleotide: V22 (≠ I41), G23 (= G42), G25 (= G44), I26 (≠ F45), L27 (≠ T46), E46 (= E65), K47 (≠ G66), E53 (≠ G72), Q54 (≠ A73), S55 (= S74), R57 (= R76), F58 (≠ N77), Y59 (≠ G78), G60 (= G79), Q61 (= Q80), A188 (≠ P215), A189 (≠ V216)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 218, 219, 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
24% identity, 96% coverage: 18:436/436 of query aligns to 10:419/824 of Q8GAI3
- W66 (≠ G75) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R76) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Query Sequence
>AO353_24770 FitnessBrowser__pseudo3_N2E3:AO353_24770
MNQIAINLSAEHARSYYNASANAMVQHPTLTSDLQADVCVIGGGFTGVNTAIELAQRGLS
VILLEGRRIGWGASGRNGGQLIRGIGHDVSGFARYVGQEGVRYLERAGIESVEVVGNRIR
EHGIDCDLRWGFCELANTPAQFAAFQVEQETLDAQGYAHATRLVRPEDMRQVVNSGVYAG
GLVDMGSGHLHPLNLVLGEARVAESLGVRIFEQSPVLEIIHGSTVQVRCAGGTVRAGSLV
LGCNAHLEDLEPRLSGKVLPAGSYIIATEPLSAQAAAELIPQNLALCDQKVGLDYYRLSA
DRRLLFGGACHYSGRDPTDIAAYMRPKMLKVFPQLTDVRIDYQWGGRIGITANRFPQVGR
LSQYPNVFYAQGYSGHGLNVTHWTARLLAEAIHAGHSHGLDVFSAVPHMTFPGGRALRTP
LLALGMLWHRLREVLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory