SitesBLAST
Comparing AO353_25075 FitnessBrowser__pseudo3_N2E3:AO353_25075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
32% identity, 25% coverage: 73:178/432 of query aligns to 203:300/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
31% identity, 25% coverage: 73:178/432 of query aligns to 203:300/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 73% coverage: 79:393/432 of query aligns to 63:398/446 of A0A0H2VG78
- R102 (= R126) mutation to A: Loss of transport activity.
- I105 (≠ Q129) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E146) mutation to A: Loss of transport activity.
- Q137 (= Q165) mutation to A: Loss of transport activity.
- Q250 (vs. gap) mutation to A: Loss of transport activity.
- Q251 (vs. gap) mutation to A: Loss of transport activity.
- N256 (≠ T252) mutation to A: Loss of transport activity.
- W357 (vs. gap) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
A1Z8N1 Facilitated trehalose transporter Tret1-1; DmTret1-1 from Drosophila melanogaster (Fruit fly) (see paper)
26% identity, 77% coverage: 82:413/432 of query aligns to 461:811/857 of A1Z8N1
Sites not aligning to the query:
- 248 modified: Phosphoserine
- 249 modified: Phosphoserine
- 250 modified: Phosphoserine
- 320 modified: Phosphoserine
- 322 modified: Phosphoserine
- 845 modified: Phosphoserine
- 846 modified: Phosphoserine
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 25% coverage: 73:178/432 of query aligns to 217:314/742 of Q02563
Sites not aligning to the query:
- 196:200 mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 mutation Missing: No change in uptake of BoNT/D or BoNT/E.
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
Query Sequence
>AO353_25075 FitnessBrowser__pseudo3_N2E3:AO353_25075
MMKTTTQDTRSKGSKLGAILRVTSGNFLEQFDFFLFGFYATYISQTFFPTTSEFASLMMT
FAVFGSGFLMRPLGAIVLGAYIDKVGRRKGLIVTLSIMAAGTVLIALVPGYASIGIAAPI
LVLLGRLLQGFSAGAEMGGVSVYLAEIATPGRRGFYTSWQSASQQVAIILAAALGYTINA
SMEAADVAAWGWRIPFFIGCLIIPFIFIIRRSLQETDAFKARSHHPSASEVFRSMRDNWR
TVLAGGLLASMTTTTFYLITVYTPTFGRSVLNLSTSDSLVVTLFVGLSNFIWLPIGGTIS
DRIGRRPLLLAVTLLCIFTAYPAMHWLAAAASFERLLAVLLYFSFFFGIYNGAMVAALTE
VMPQNVRVVGFSLAFSLATAVFGGFTPAVSTILVQATGDKASPAYWLMFAALCGFTATTI
LYRRQKAVPVNV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory