Comparing AO353_25105 FitnessBrowser__pseudo3_N2E3:AO353_25105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
30% identity, 93% coverage: 3:284/302 of query aligns to 1:291/306 of 5eynA
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
32% identity, 92% coverage: 10:287/302 of query aligns to 12:307/312 of 4wjmA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 96% coverage: 7:297/302 of query aligns to 5:302/309 of Q53W83
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
29% identity, 93% coverage: 3:284/302 of query aligns to 5:295/310 of 5yggA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
31% identity, 96% coverage: 7:296/302 of query aligns to 5:301/301 of 1v1aA
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
30% identity, 95% coverage: 7:293/302 of query aligns to 5:298/300 of 1v1bA
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
27% identity, 82% coverage: 9:256/302 of query aligns to 5:254/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 82% coverage: 9:256/302 of query aligns to 6:255/304 of 3ih0A
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
29% identity, 92% coverage: 8:284/302 of query aligns to 5:282/297 of 1tz6A
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
29% identity, 92% coverage: 8:284/302 of query aligns to 5:282/299 of 1tz3A
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 93% coverage: 3:284/302 of query aligns to 4:293/319 of Q8ZKR2
7fcaD Pfkb(mycobacterium marinum) (see paper)
33% identity, 95% coverage: 3:289/302 of query aligns to 1:275/282 of 7fcaD
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
24% identity, 93% coverage: 3:283/302 of query aligns to 1:290/308 of 3iq0B
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
24% identity, 97% coverage: 6:297/302 of query aligns to 3:308/311 of 2varA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
24% identity, 97% coverage: 6:297/302 of query aligns to 4:309/313 of Q97U29
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
25% identity, 86% coverage: 41:300/302 of query aligns to 50:298/298 of 7agkA
Sites not aligning to the query:
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
25% identity, 86% coverage: 41:300/302 of query aligns to 50:298/298 of P32143
Sites not aligning to the query:
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
25% identity, 86% coverage: 41:300/302 of query aligns to 50:298/302 of 7ag6A
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
26% identity, 96% coverage: 7:297/302 of query aligns to 6:318/322 of 3lkiB
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
26% identity, 81% coverage: 41:286/302 of query aligns to 50:280/295 of 7aghA
>AO353_25105 FitnessBrowser__pseudo3_N2E3:AO353_25105
MVLPRAVVFGEALTDLVQGTPGQWKGYPGGAPWNVARSLSRLGVSSAFAGAVSIDSLGDE
IVAQSEAAALDMSFIQRVDRDPLVAIVPSSRPPRYFFAGDADLFFDPDLMPEGWINKAEL
CHFSCISLARQPLADRLVKIAQQAKEAGKRISYDPNWRNLMDSHYREQTFPTMTTLADMI
KLSDEDLRHIYPGLTEHQAMDELRALNPQAQILFTRGEHGMILHTPDSQLDQPAIAVKVE
DTVGAGDACMAGWLAAELLGIADLRERLRFSAACASISCRHAGAHAPALADVEGLLKLLI
DT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory