Comparing AO353_25120 AO353_25120 ABC transporter permease to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
39% identity, 90% coverage: 22:309/320 of query aligns to 3:276/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 84% coverage: 25:292/320 of query aligns to 28:286/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
30% identity, 68% coverage: 99:317/320 of query aligns to 284:514/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
30% identity, 65% coverage: 99:307/320 of query aligns to 269:489/490 of 4ki0F
>AO353_25120 AO353_25120 ABC transporter permease
MSVSTTHASCDELLLTRETPIQRRRVRAAWLFLTPMLLCLALVAAWPLLRTFWFSLTDAN
LADTSGGSFVGLSNYLFHDGSNWSGILVDPQWWNAVRNTLHFTVVSVGLEIVLGLLVALL
LNIKFTGRSLVRALILIPWAIPTIVSAKIWSWMLNDQFGIINHLMLSLGLIDAPLAWTAD
ADLSMWAVIIVDVWKTVPFVTLLMLAALQMLPSDCYEAARVDGIHPLKVFWRVTLPLLMP
ALLVAAIFRILDSLRVFDVIYVLTSNSSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLV
VAVIAMLYLYLGRRQLEVRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory