SitesBLAST
Comparing AO353_26740 FitnessBrowser__pseudo3_N2E3:AO353_26740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yrvAAA structure of fap after illumination at 100k (see paper)
37% identity, 97% coverage: 8:540/550 of query aligns to 8:570/573 of 6yrvAAA
- binding carbon dioxide: R375 (≠ H362), N499 (≠ F471)
- binding flavin-adenine dinucleotide: G14 (= G14), G16 (= G16), T17 (≠ P17), A18 (= A18), L37 (= L37), E38 (= E38), A39 (= A39), F58 (≠ I58), W64 (= W65), A82 (≠ P83), G89 (= G90), S90 (= S91), N94 (= N95), A95 (≠ G96), T96 (≠ M97), L97 (≠ I98), M191 (≠ N191), V222 (= V222), C264 (≠ S255), A265 (= A256), G266 (= G257), H269 (≠ G260), N499 (≠ F471), A534 (= A504), Q544 (≠ N514), T545 (= T515), G546 (≠ C516)
- binding heptadecane: V377 (≠ Q364), G379 (vs. gap), M380 (≠ L366), G386 (= G372), T389 (≠ L375), Y390 (≠ H376), F393 (= F378), T408 (= T382), Q410 (≠ S384)
A0A248QE08 Fatty acid photodecarboxylase, chloroplastic; CvFAP; EC 4.1.1.106 from Chlorella variabilis (Green alga) (see paper)
37% identity, 96% coverage: 8:535/550 of query aligns to 84:641/654 of A0A248QE08
- TA 93:94 (≠ PA 17:18) binding
- E114 (= E38) binding
- L162 (≠ V87) binding
- S166 (= S91) binding
- NATL 170:173 (≠ NGMI 95:98) binding
- V298 (= V222) binding
- C432 (≠ S342) binding
- R451 (≠ H362) binding
- Y466 (≠ H376) binding
- Q486 (≠ S384) binding
- G622 (≠ C516) binding
5nccA Structure of fatty acid photodecarboxylase in complex with fad and palmitic acid (see paper)
37% identity, 97% coverage: 8:539/550 of query aligns to 24:578/578 of 5nccA
- active site: R347 (≠ K322), L420 (≠ V385), I421 (≠ C386), S507 (≠ I470), A509 (≠ H472), G552 (= G513), Q553 (≠ N514)
- binding flavin-adenine dinucleotide: G30 (= G14), G32 (= G16), T33 (≠ P17), A34 (= A18), L53 (= L37), E54 (= E38), A55 (= A39), F74 (≠ I58), W80 (= W65), A98 (≠ P83), G100 (= G85), G105 (= G90), S106 (= S91), N110 (= N95), A111 (≠ G96), T112 (≠ M97), L113 (≠ I98), V238 (= V222), A278 (= A256), H282 (≠ G260), L286 (≠ I264), N508 (≠ F471), Q553 (≠ N514), T554 (= T515), G555 (≠ C516), V558 (≠ T519)
8b7sA Crystal structure of the chloramphenicol-inactivating oxidoreductase from novosphingobium sp (see paper)
31% identity, 95% coverage: 8:530/550 of query aligns to 5:450/458 of 8b7sA
- binding flavin-adenine dinucleotide: G11 (= G14), G13 (= G16), S14 (≠ P17), A15 (= A18), E35 (= E38), A36 (= A39), W47 (= W65), P65 (= P83), G67 (= G85), V180 (= V222), A214 (= A256), G215 (= G257), A218 (≠ G260), T270 (≠ M339), Y391 (≠ F471), A424 (= A504), I435 (≠ T515), N436 (≠ C516)
3t37A Crystal structure of pyridoxine 4-oxidase from mesorbium loti
36% identity, 95% coverage: 9:528/550 of query aligns to 3:502/509 of 3t37A
- active site: F360 (≠ V385), G361 (≠ C386), H444 (≠ I470), H446 (= H472), G487 (= G513), P488 (≠ N514)
- binding flavin-adenine dinucleotide: G8 (= G14), G10 (= G16), S11 (≠ P17), A12 (= A18), E32 (= E38), A33 (= A39), W58 (= W65), R77 (= R84), G78 (= G85), R79 (≠ K86), G83 (= G90), S84 (= S91), H88 (≠ N95), A89 (≠ G96), G91 (≠ I98), R217 (≠ D221), V218 (= V222), A251 (= A256), E255 (≠ G260), H445 (≠ F471), A478 (= A504), P488 (≠ N514), I489 (≠ T515), H490 (≠ C516)
4ha6A Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex (see paper)
36% identity, 95% coverage: 9:528/550 of query aligns to 3:502/508 of 4ha6A
- active site: F360 (≠ V385), G361 (≠ C386), H444 (≠ I470), H446 (= H472), G487 (= G513), P488 (≠ N514)
- binding flavin-adenine dinucleotide: G8 (= G14), G10 (= G16), S11 (≠ P17), A12 (= A18), E32 (= E38), A33 (= A39), W58 (= W65), R77 (= R84), G78 (= G85), G83 (= G90), S84 (= S91), L87 (≠ I94), H88 (≠ N95), A89 (≠ G96), M90 (= M97), G91 (≠ I98), V218 (= V222), A251 (= A256), G252 (= G257), E255 (≠ G260), H445 (≠ F471), A478 (= A504), P488 (≠ N514), I489 (≠ T515), H490 (≠ C516)
- binding 4-(aminomethyl)-5-(hydroxymethyl)-2-methylpyridin-3-ol: A89 (≠ G96), S314 (vs. gap), H444 (≠ I470), H446 (= H472)
5oc1A Crystal structure of aryl-alcohol oxidase from pleurotus eryngii in complex with p-anisic acid (see paper)
31% identity, 95% coverage: 8:532/550 of query aligns to 2:563/565 of 5oc1A
- active site: V339 (≠ M325), N413 (≠ V385), A414 (≠ C386), I499 (= I470), H501 (= H472), A544 (≠ G513), H545 (≠ N514)
- binding 4-methoxybenzoic acid: Y91 (≠ G96), I356 (vs. gap), I390 (≠ L366), F396 (≠ G372), T412 (≠ S384), I499 (= I470), H501 (= H472), H545 (≠ N514)
- binding flavin-adenine dinucleotide: G8 (= G14), G10 (= G16), N11 (≠ P17), A12 (= A18), E32 (= E38), A33 (= A39), W60 (= W65), P78 (= P83), G80 (= G85), G85 (= G90), S86 (= S91), H90 (≠ N95), Y91 (≠ G96), V93 (≠ I98), V230 (= V222), S270 (= S255), A271 (= A256), G272 (= G257), F500 (= F471), H545 (≠ N514), T546 (= T515), Q547 (≠ C516), I550 (≠ T519)
3fimB Crystal structure of aryl-alcohol-oxidase from pleurotus eryingii (see paper)
31% identity, 95% coverage: 8:532/550 of query aligns to 2:563/565 of 3fimB
- active site: V339 (≠ M325), N413 (≠ V385), A414 (≠ C386), I499 (= I470), H501 (= H472), A544 (≠ G513), H545 (≠ N514)
- binding flavin-adenine dinucleotide: G8 (= G14), N11 (≠ P17), A12 (= A18), E32 (= E38), A33 (= A39), W60 (= W65), P78 (= P83), G80 (= G85), G85 (= G90), S86 (= S91), H90 (≠ N95), Y91 (≠ G96), V93 (≠ I98), V230 (= V222), S270 (= S255), A271 (= A256), F500 (= F471), H501 (= H472), H545 (≠ N514), T546 (= T515), Q547 (≠ C516), I550 (≠ T519)
E4QP00 5-(hydroxymethyl)furfural oxidase; 5-hydroxymethylfurfural oxidase; HMFO; Thiol oxidase; EC 1.1.3.47; EC 1.8.3.- from Methylovorus sp. (strain MP688) (see paper)
35% identity, 95% coverage: 8:531/550 of query aligns to 6:528/531 of E4QP00
- V101 (≠ I94) mutation to H: Abolishes activity.
- M103 (≠ G96) mutation to A: 16-fold reduction in catalytic efficiency on vanillyl alcohol.
- V367 (≠ T382) mutation to K: 1.6-fold reduction in catalytic efficiency on vanillyl alcohol. Shows significantly improved activity on the aldehyde 5-formyl-2-furancarboxylate, which results in a better 5-hydroxymethylfurfural to 2,5-furandicarboxylate conversion.; mutation to R: 1.4-fold reduction in catalytic efficiency on vanillyl alcohol. Shows significantly improved activity on the aldehyde 5-formyl-2-furancarboxylate, which results in a better 5-hydroxymethylfurfural to 2,5-furandicarboxylate conversion. Displays a catalytic efficiency toward 5-formyl-2-furancarboxylate that is over 1000-fold higher than that for wild-type; when associated with F-466.
- W369 (≠ S384) mutation to A: 7.5-fold reduction in catalytic efficiency on vanillyl alcohol.
- V465 (≠ I470) mutation to A: 18-fold reduction in catalytic efficiency on vanillyl alcohol.
- W466 (≠ F471) mutation to A: 39-fold reduction in catalytic efficiency on vanillyl alcohol. In contrast to wild-type, is active on secondary alcohols, such as (S)-1-phenylethanol, and is strictly enantionselective as this mutant has no activity on (R)-1-phenylethanol. Shows increased activity on the aldehyde 5-formyl-2-furancarboxylate.; mutation to F: 3.4-fold reduction in catalytic efficiency on vanillyl alcohol. In contrast to wild-type, is active on secondary alcohols, such as (S)-1-phenylethanol, and is strictly enantionselective as this mutant has no activity on (R)-1-phenylethanol. Shows increased activity on the aldehyde 5-formyl-2-furancarboxylate. Displays a catalytic efficiency toward 5-formyl-2-furancarboxylate that is over 1000-fold higher than that for wild-type; when associated with R-367.
- H467 (= H472) mutation to A: Abolishes activity.
- N511 (= N514) mutation to A: 53-fold reduction in catalytic efficiency on vanillyl alcohol.
4udqA Crystal structure of 5-hydroxymethylfurfural oxidase (hmfo) in the reduced state
35% identity, 95% coverage: 8:531/550 of query aligns to 2:524/525 of 4udqA
- active site: L331 (= L344), F364 (≠ A383), W365 (≠ S384), V461 (≠ I470), H463 (= H472), A506 (≠ G513), N507 (= N514)
- binding flavin-adenine dinucleotide: G8 (= G14), G10 (= G16), T11 (≠ P17), A12 (= A18), E32 (= E38), A33 (= A39), W64 (= W65), G88 (= G85), G93 (= G90), G94 (≠ S91), N98 (= N95), M99 (≠ G96), V101 (≠ I98), V229 (= V222), T261 (≠ S255), A262 (= A256), W462 (≠ F471), H463 (= H472), A497 (= A504), N507 (= N514), T508 (= T515), N509 (≠ C516), T512 (= T519)
8bxlB Patulin synthase from penicillium expansum
30% identity, 95% coverage: 3:527/550 of query aligns to 9:583/590 of 8bxlB
- binding flavin-adenine dinucleotide: G20 (= G14), G22 (= G16), T23 (≠ P17), A24 (= A18), E44 (= E38), A45 (= A39), W80 (= W65), G100 (= G85), G105 (= G90), S106 (= S91), R109 (≠ I94), N110 (= N95), Y111 (≠ G96), A113 (≠ I98), L253 (≠ D221), A254 (≠ V222), A288 (= A256), Q292 (≠ G260), F525 (= F471), D559 (= D503), A560 (= A504), H570 (≠ N514), P571 (≠ T515), Q572 (≠ C516), L575 (≠ T519)
6ze6A Fad-dependent oxidoreductase from chaetomium thermophilum in complex with fragment 4-nitrocatechol (see paper)
30% identity, 95% coverage: 8:530/550 of query aligns to 2:578/585 of 6ze6A
- binding 4-nitrocatechol: I75 (≠ P83), L92 (≠ M100), Q306 (≠ H297), V360 (≠ A346), Y431 (≠ C386), L433 (= L388), N514 (≠ G467), S516 (≠ T469), N517 (≠ I470), H519 (= H472), G561 (= G513), S562 (≠ N514)
- binding dihydroflavine-adenine dinucleotide: G8 (= G14), G10 (= G16), I11 (≠ P17), S12 (≠ A18), E32 (= E38), A33 (= A39), W56 (≠ P51), A77 (≠ G85), G82 (= G90), G83 (≠ S91), N87 (= N95), A88 (≠ G96), V90 (≠ I98), L227 (≠ D221), V228 (= V222), A265 (= A256), A518 (≠ F471), H519 (= H472), D551 (= D503), I552 (≠ A504), S562 (≠ N514), P563 (≠ T515), M564 (≠ C516)
6ze5A Fad-dependent oxidoreductase from chaetomium thermophilum in complex with fragment 2-(1h-indol-3-yl)-n-[(1-methyl-1h-pyrrol-2-yl) methyl]ethanamine (see paper)
30% identity, 95% coverage: 8:530/550 of query aligns to 2:578/585 of 6ze5A
- binding 2-(1H-indol-3-yl)-N-[(1-methyl-1H-pyrrol-2-yl)methyl]ethanamine: I75 (≠ P83), V90 (≠ I98), Y431 (≠ C386), N517 (≠ I470), D576 (≠ Q528)
- binding dihydroflavine-adenine dinucleotide: G8 (= G14), G10 (= G16), I11 (≠ P17), S12 (≠ A18), E32 (= E38), A33 (= A39), W56 (≠ P51), A77 (≠ G85), G82 (= G90), G83 (≠ S91), N87 (= N95), A88 (≠ G96), V90 (≠ I98), L227 (≠ D221), V228 (= V222), A265 (= A256), A518 (≠ F471), H519 (= H472), D551 (= D503), I552 (≠ A504), S562 (≠ N514), P563 (≠ T515), M564 (≠ C516)
Sites not aligning to the query:
6ze4A Fad-dependent oxidoreductase from chaetomium thermophilum in complex with fragment 4-oxo-n-[(1s)-1-(pyridin-3-yl)ethyl]-4-(thiophen-2-yl) butanamide (see paper)
30% identity, 95% coverage: 8:530/550 of query aligns to 2:578/585 of 6ze4A
- binding 4-oxo-N-[(1S)-1-(pyridin-3-yl)ethyl]-4-(thiophen-2-yl)butanamide: A88 (≠ G96), V90 (≠ I98), L354 (vs. gap), H421 (= H376), L429 (≠ S384), Y431 (≠ C386), N517 (≠ I470)
- binding dihydroflavine-adenine dinucleotide: G8 (= G14), G10 (= G16), I11 (≠ P17), S12 (≠ A18), E32 (= E38), A33 (= A39), W56 (≠ P51), A77 (≠ G85), G82 (= G90), G83 (≠ S91), N87 (= N95), A88 (≠ G96), V90 (≠ I98), L227 (≠ D221), V228 (= V222), A265 (= A256), A518 (≠ F471), H519 (= H472), D551 (= D503), I552 (≠ A504), S562 (≠ N514), P563 (≠ T515), M564 (≠ C516)
6ze3A Fad-dependent oxidoreductase from chaetomium thermophilum in complex with fragment (4-methoxycarbonylphenyl)methylazanium (see paper)
30% identity, 95% coverage: 8:530/550 of query aligns to 2:578/585 of 6ze3A
- binding (4-methoxycarbonylphenyl)methylazanium: A88 (≠ G96), L354 (vs. gap), Y431 (≠ C386), N517 (≠ I470)
- binding dihydroflavine-adenine dinucleotide: G10 (= G16), I11 (≠ P17), S12 (≠ A18), E32 (= E38), A33 (= A39), W56 (≠ P51), G82 (= G90), G83 (≠ S91), I86 (= I94), N87 (= N95), A88 (≠ G96), V90 (≠ I98), L227 (≠ D221), V228 (= V222), A265 (= A256), A518 (≠ F471), H519 (= H472), D551 (= D503), I552 (≠ A504), S562 (≠ N514), M564 (≠ C516)
6ze7B Chaetomium thermophilum fad-dependent oxidoreductase in complex with 4-nitrophenol (see paper)
30% identity, 95% coverage: 8:530/550 of query aligns to 3:579/586 of 6ze7B
- binding dihydroflavine-adenine dinucleotide: G9 (= G14), G11 (= G16), I12 (≠ P17), S13 (≠ A18), E33 (= E38), A34 (= A39), W57 (≠ P51), A78 (≠ G85), G83 (= G90), G84 (≠ S91), N88 (= N95), A89 (≠ G96), V91 (≠ I98), L228 (≠ D221), V229 (= V222), A266 (= A256), A519 (≠ F471), H520 (= H472), D552 (= D503), I553 (≠ A504), S563 (≠ N514), P564 (≠ T515), M565 (≠ C516)
- binding p-nitrophenol: L93 (≠ M100), V361 (≠ A346), Y432 (≠ C386), L434 (= L388), G562 (= G513), S563 (≠ N514)
7aa2A Chaetomium thermophilum fad-dependent oxidoreductase in complex with abts (see paper)
30% identity, 95% coverage: 8:530/550 of query aligns to 2:578/584 of 7aa2A
- binding 3-ethyl-2-[(2z)-2-(3-ethyl-6-sulfo-1,3-benzothiazol-2(3h)-ylidene)hydrazino]-6-sulfo-3h-1,3-benzothiazol-1-ium: W52 (= W47), A88 (≠ G96), V90 (≠ I98), L354 (vs. gap), Y431 (≠ C386), N517 (≠ I470), H519 (= H472), S562 (≠ N514)
- binding dihydroflavine-adenine dinucleotide: G8 (= G14), G10 (= G16), I11 (≠ P17), S12 (≠ A18), E32 (= E38), A33 (= A39), W56 (≠ P51), A77 (≠ G85), G82 (= G90), G83 (≠ S91), I86 (= I94), N87 (= N95), A88 (≠ G96), V90 (≠ I98), L227 (≠ D221), V228 (= V222), A265 (= A256), A518 (≠ F471), H519 (= H472), D551 (= D503), I552 (≠ A504), S562 (≠ N514), P563 (≠ T515), M564 (≠ C516)
4ynuA Crystal structure of aspergillus flavus fadgdh in complex with d- glucono-1,5-lactone (see paper)
30% identity, 95% coverage: 8:530/550 of query aligns to 4:562/569 of 4ynuA
- active site: V341 (vs. gap), F412 (≠ V385), W413 (≠ C386), N501 (≠ I470), H503 (= H472), G545 (= G513), H546 (≠ N514)
- binding flavin-adenine dinucleotide: G12 (= G16), T13 (≠ P17), S14 (≠ A18), E34 (= E38), A35 (= A39), Y51 (= Y54), F55 (≠ I58), W61 (= W65), R79 (≠ P83), G81 (= G85), G86 (= G90), T87 (≠ S91), N91 (= N95), G92 (= G96), T232 (≠ D221), A233 (≠ V222), A273 (= A256), G274 (= G257), R277 (≠ G260), F502 (= F471), A536 (= A504), H546 (≠ N514), L547 (≠ T515), V548 (≠ C516), L551 (≠ T519)
- binding D-glucono-1,5-lactone: Y51 (= Y54), E411 (≠ S384), A496 (≠ R465), N497 (≠ I466), R499 (≠ T468), R499 (≠ T468), N501 (≠ I470), H503 (= H472), H546 (≠ N514)
7vzsA Fad-dpendent glucose dehydrogenase complexed with an inhibitor at ph7.56
30% identity, 95% coverage: 8:530/550 of query aligns to 4:562/566 of 7vzsA
- binding D-glucal: Y6 (= Y10), L22 (= L26), N25 (= N29), Y51 (= Y54), I349 (≠ P336), Q356 (= Q343), E411 (≠ S384), E444 (≠ P417), W445 (≠ E418), K448 (≠ R421), R499 (≠ T468), N501 (≠ I470), H546 (≠ N514)
- binding flavin-adenine dinucleotide: G10 (= G14), G12 (= G16), T13 (≠ P17), S14 (≠ A18), E34 (= E38), A35 (= A39), Y51 (= Y54), F55 (≠ I58), W61 (= W65), R79 (≠ P83), G81 (= G85), G86 (= G90), T87 (≠ S91), N91 (= N95), G92 (= G96), M93 (= M97), A94 (≠ I98), T232 (≠ D221), A233 (≠ V222), A273 (= A256), G274 (= G257), R277 (≠ G260), F502 (= F471), A536 (= A504), H546 (≠ N514), L547 (≠ T515), V548 (≠ C516), L551 (≠ T519)
Sites not aligning to the query:
4yntA Crystal structure of aspergillus flavus fad glucose dehydrogenase (see paper)
30% identity, 95% coverage: 8:530/550 of query aligns to 5:563/570 of 4yntA
- active site: V342 (vs. gap), F413 (≠ V385), W414 (≠ C386), N502 (≠ I470), H504 (= H472), G546 (= G513), H547 (≠ N514)
- binding dihydroflavine-adenine dinucleotide: G13 (= G16), T14 (≠ P17), S15 (≠ A18), E35 (= E38), A36 (= A39), F56 (≠ I58), W62 (= W65), R80 (≠ P83), G82 (= G85), G87 (= G90), T88 (≠ S91), N92 (= N95), G93 (= G96), M94 (= M97), A95 (≠ I98), A234 (≠ V222), A274 (= A256), R278 (≠ G260), F503 (= F471), A537 (= A504), H547 (≠ N514), L548 (≠ T515), V549 (≠ C516), L552 (≠ T519)
Query Sequence
>AO353_26740 FitnessBrowser__pseudo3_N2E3:AO353_26740
MQPAVDAYDYIVVGAGPAGCLLANRLSANPQHRVLLLEAGGRDNYPWIHIPVGYLYCIGN
PRTDWCFKTEAQTGLQGRSLSYPRGKVLGGSSSINGMIYMRGQAGDYDRWAAEGNPGWSW
NDVLPLFKQSENHFAGDSAFHGAAGEWRVERQRLSWPILDAFRSAAEQSGIASVDDFNQG
DNEGCGYFQVNQKAGVRWNAAKAFLKPVRHRPNLTVLTSVDVDRVLLENGRASRVSARWQ
GQVNIFAARREIILSAGSVGSPSILQRSGIGPGDLLKRLGIGVAHELNGVGRNLQDHLQL
RLIYKLENARTLNQIAGSLWGKIGMGLRYLYDRSGPLSMAPSQLGAFARSGPEQTSANLE
YHVQPLSLERFGEPLHAFPAFTASVCDLRPQSRGRVEIRSADPQQPPLIQPNYLSHPEDL
RVAAEAIRLTRRIVAAPALQPFNPVEYLPGAALQSEEQLHEAAARIGTTIFHPVGTCRMG
NDADAVVDAQLRVHGIPGLRIADASIMPHITSGNTCSPTLMIAEKAAQLILAASTWNATA
EIERVTEPHL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory