SitesBLAST
Comparing AO353_26790 FitnessBrowser__pseudo3_N2E3:AO353_26790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77454 Glutaminase 1; EC 3.5.1.2 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 94% coverage: 19:302/302 of query aligns to 24:308/310 of P77454
- K69 (= K64) mutation to A: Loss of activity.
- N117 (= N111) mutation to A: Loss of activity.
- S160 (= S154) mutation to A: Loss of activity.
- E161 (= E155) mutation to A: Strongly reduced activity.
- Q162 (≠ Y156) mutation to A: No effect.
- N168 (= N162) mutation to A: Loss of activity.
- Y192 (= Y186) mutation to A: Loss of activity.
- Y244 (= Y238) mutation to A: Loss of activity.
- S260 (= S254) mutation to A: Reduced activity.
- K294 (≠ A288) modified: N6-acetyllysine
3ihbA Crystal structure analysis of mglu in its tris and glutamate form (see paper)
37% identity, 93% coverage: 16:295/302 of query aligns to 19:300/450 of 3ihbA
- active site: S64 (= S61), K67 (= K64), Y191 (= Y186), Y243 (= Y238), V261 (= V256)
- binding glutamic acid: Q63 (= Q60), S64 (= S61), N114 (= N111), E160 (= E155), N167 (= N162), G260 (= G255), V261 (= V256)
6umfA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6umfA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N-(5-{[1-(5-amino-1,3,4-thiadiazol-2-yl)piperidin-4-yl]oxy}-1,3,4-thiadiazol-2-yl)-2-phenylacetamide: L185 (= L95), L187 (≠ E99), Y258 (≠ L168)
6uljA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6uljA
6ulaA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6ulaA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-cyclopropyl-N-{5-[4-({5-[(cyclopropylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), Y258 (≠ L168)
6ukbA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6ukbA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N-[5-(4-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]oxy}piperidin-1-yl)-1,3,4-thiadiazol-2-yl]acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), Y258 (≠ L168)
6ujmA Crystal structure of human gac in complex with inhibitor upgl00013
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6ujmA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N-{5-[(3R)-3-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]amino}pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), Y258 (≠ L168)
6umcB Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 6umcB
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-N-{5-[(3R)-3-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), E189 (= E101), Y258 (≠ L168)
6ujgA Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 6ujgA
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N-{5-[(3S)-3-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]amino}pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), Y258 (≠ L168)
5wj6A Crystal structure of glutaminasE C in complex with inhibitor 2-phenyl- n-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino) piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide (upgl-00004) (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 5wj6A
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-N-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ P91), K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), E189 (= E101), Y258 (≠ L168)
5i94A Crystal structure of human glutaminasE C in complex with the inhibitor upgl-00019 (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 5i94A
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-N-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ P91), K184 (≠ S94), L185 (= L95), F186 (≠ L98), Y258 (≠ L168)
8jubA Crystal structure of glutaminasE C in complex with compound 27 (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 87:371/401 of 8jubA
5w2jB Crystal structure of dimeric form of mouse glutaminasE C (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 96:380/411 of 5w2jB
Sites not aligning to the query:
8jueA Crystal structure of glutaminasE C in complex with compound 11 (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 88:372/401 of 8jueA
6loxA Crystal structure of human glutaminase with macrocyclic inhibitor (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 93:377/407 of 6loxA
- active site: S148 (= S61), K151 (= K64), Y276 (= Y186), Y328 (= Y238), V346 (= V256)
- binding (E)-15,22-Dioxa-4,11-diaza-5(2,5)-thiadiazola-10(3,6)-pyridazina-1,14(1,3)-dibenzenacyclodocosaphan-18-ene-3,12-dione: K182 (≠ S94), L183 (= L95), F184 (≠ L98), L185 (≠ E99), N186 (≠ F100), Y256 (≠ L168)
5uqeD Multidomain structure of human kidney-type glutaminase(kga/gls) (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/507 of 5uqeD
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding N,N'-[sulfanediylbis(ethane-2,1-diyl-1,3,4-thiadiazole-5,2-diyl)]bis(2-phenylacetamide): K184 (≠ S94), L185 (= L95), D191 (≠ G103), Y258 (≠ L168)
6umdB Crystal structure of human gac in complex with inhibitor upgl00012
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6umdB
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-(pyridin-3-yl)-N-(5-{4-[(5-{[(pyridin-3-yl)acetyl]amino}-1,3,4-thiadiazol-2-yl)amino]piperidin-1-yl}-1,3,4-thiadiazol-2-yl)acetamide: R181 (≠ P91), K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), E189 (= E101), Y258 (≠ L168)
6ul9B Crystal structure of human gac in complex with inhibitor upgl00023
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/409 of 6ul9B
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-N-{5-[(1-{5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}azetidin-3-yl)oxy]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ P91), K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), N188 (≠ F100), E189 (= E101), Y258 (≠ L168)
O94925 Glutaminase kidney isoform, mitochondrial; GLS; K-glutaminase; L-glutamine amidohydrolase; EC 3.5.1.2 from Homo sapiens (Human) (see 5 papers)
35% identity, 94% coverage: 5:287/302 of query aligns to 231:515/669 of O94925
- Y249 (= Y24) mutation to A: Loss of enzyme activity.
- S286 (= S61) binding ; mutation to A: Loss of enzyme activity.
- K289 (= K64) mutation to A: Loss of enzyme activity.
- P313 (= P87) to L: in GDPAG; loss of enzyme activity; dbSNP:rs1558973667
- F318 (= F92) mutation to Y: No effect on catalytic activity. Loss of inhibition by BPTES; when associated with S-322.
- L321 (= L95) mutation to A: Decreased enzyme activity.
- F322 (≠ V96) mutation to S: No effect on catalytic activity. Loss of inhibition by BPTES; when associated with Y-318.
- L323 (≠ Q97) mutation to A: Decreased enzyme activity.
- N335 (= N111) binding
- E381 (= E155) binding
- N388 (= N162) binding
- Y394 (≠ L168) mutation to A: Decreased enzyme activity.; mutation to L: No effect on catalytic activity. Loss of inhibition by BPTES.
- Y414 (= Y186) binding
- Y466 (= Y238) binding ; mutation to A: Loss of enzyme activity.
- S482 (= S254) to C: in CASGID; increased enzyme activity; dbSNP:rs1558986214
- V484 (= V256) binding
5fi7A Crystal structure of human gac in complex with inhibitor upgl_00015: 2-phenyl-~{n}-[5-[(3~{s})-3-[[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide (see paper)
35% identity, 94% coverage: 5:287/302 of query aligns to 95:379/410 of 5fi7A
- active site: S150 (= S61), K153 (= K64), Y278 (= Y186), Y330 (= Y238), V348 (= V256)
- binding 2-phenyl-~{N}-[5-[(3~{S})-3-[[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide: K184 (≠ S94), L185 (= L95), F186 (≠ L98), L187 (≠ E99), E189 (= E101), Y258 (≠ L168)
Query Sequence
>AO353_26790 FitnessBrowser__pseudo3_N2E3:AO353_26790
MQALLNEILDTVRPLIGQGKVANYIPALGSVPADQLGIAVYGNDGELYCAGDAHTLFSVQ
SISKVFSLVQAIEHSGEAIWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDI
NQSRFAAPALSMRDFVRRLSGNPQVMVDSKVAESEYQHRARNAAMAYLMQSFGNFHNDVE
AVLRSYFSHCALRMSCVDLARAFCFLANDGFCKHSGEQILTARQTKQVNSIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGRFTVCVWSPELNPAGNSLAGMAALELLSQRIGWS
VF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory