SitesBLAST
Comparing AO353_26910 FitnessBrowser__pseudo3_N2E3:AO353_26910 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 80% coverage: 10:356/436 of query aligns to 67:419/534 of P53322
- K283 (≠ P220) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
23% identity, 91% coverage: 20:417/436 of query aligns to 1:391/409 of 6e9nA
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 91% coverage: 20:417/436 of query aligns to 12:410/430 of P0AA76
- Y29 (= Y38) binding
- D31 (= D40) mutation to N: Loss of galactonate transport activity.
- R32 (= R41) binding
- Y64 (= Y73) binding
- E118 (= E127) mutation to Q: Loss of galactonate transport activity.
- W358 (= W365) binding
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
23% identity, 66% coverage: 67:354/436 of query aligns to 113:400/495 of Q9NRA2
- K136 (≠ R90) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ V135) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ IM 150:151) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (vs. gap) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ ---RA 223:224) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G291) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P297) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ P325) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
23% identity, 91% coverage: 20:417/436 of query aligns to 4:375/393 of 6e9oA
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
22% identity, 96% coverage: 10:426/436 of query aligns to 4:456/493 of Q03567
- N69 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
23% identity, 69% coverage: 56:354/436 of query aligns to 102:400/495 of Q8BN82
- H183 (≠ V135) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 66% coverage: 67:354/436 of query aligns to 113:400/495 of Q5Q0U0
- K136 (≠ L95) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R120) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ T123) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G124) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E127) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A128) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (= F131) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P132) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ V135) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ L138) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ ADQAI 228:232) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P297) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (≠ P325) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 53% coverage: 55:286/436 of query aligns to 37:273/446 of A0A0H2VG78
- R102 (= R120) mutation to A: Loss of transport activity.
- I105 (≠ T123) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (≠ Q140) mutation to A: Loss of transport activity.
- Q137 (≠ M155) mutation to A: Loss of transport activity.
- Q250 (= Q265) mutation to A: Loss of transport activity.
- Q251 (≠ S266) mutation to A: Loss of transport activity.
- N256 (≠ Y269) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 357 W→A: Loss of transport activity.
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
21% identity, 89% coverage: 41:426/436 of query aligns to 88:492/582 of Q9JI12
- R88 (= R41) mutation to A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
- H128 (≠ A66) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R120) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E127) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ I264) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
19% identity, 56% coverage: 49:294/436 of query aligns to 126:358/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
20% identity, 89% coverage: 41:426/436 of query aligns to 30:434/452 of 7t3nA
Sites not aligning to the query:
Query Sequence
>AO353_26910 FitnessBrowser__pseudo3_N2E3:AO353_26910
MSQSAAATLATDDDKNAVYKRVTLRLIPFIFVCYLFNYLDRVNVGFAKLQMLDALKFSET
VYGLGAGIFFIGYVLCGVPSNLALTRFGPRRWIALMMVTWGMLSTCLLFVTTPTGFYTLR
LFTGAAEAGFFPGVVLYLSQWFPTFRRGRIMALFMSAIPVSGLLGSPFSGWILNHFAAGQ
GGLAGWQWMFLLQGIPTITLGALAFFLLSDNFASAKWLKPEERAVLEADQAIDWASKPKT
ATDSLLAVFKNPAIWAFGLIYFCIQSGVYAINFWLPSIIKNLGFADNLVIGWLSAIPYLL
AAVFMLMVGRSADLHKERRWHLVVPMLMGAVGLLIAVNFAANPAIAILGLTIATMGALTG
LPMFWPVPTAMLSAGAAAGGLALINSMGQMAGFLSPYLVGWVKDSTGSTDAALYLLAGVI
VCGSLLALRMTRTLRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory