SitesBLAST
Comparing AO353_27070 FitnessBrowser__pseudo3_N2E3:AO353_27070 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
37% identity, 89% coverage: 6:165/179 of query aligns to 5:146/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ L41), C41 (= C43), G44 (= G46), C46 (= C48), G47 (≠ H49), C49 (= C51), C61 (= C68), C100 (= C113), G101 (≠ S114), C103 (= C116), C135 (= C154), C137 (= C156)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C137 (= C156)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
33% identity, 94% coverage: 6:173/179 of query aligns to 5:155/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G42), C41 (= C43), D42 (≠ G44), G44 (= G46), C46 (= C48), G47 (≠ H49), C49 (= C51), C61 (= C68), C101 (= C113), G102 (≠ S114), C104 (= C116), C136 (= C154), C138 (= C156)
- binding pterin cytosine dinucleotide: Q100 (= Q112), C138 (= C156)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
34% identity, 97% coverage: 1:173/179 of query aligns to 1:156/166 of P19921
- C42 (= C43) binding
- C47 (= C48) binding
- C50 (= C51) binding
- C62 (= C68) binding
- C102 (= C113) binding
- C105 (= C116) binding
- C137 (= C154) binding
- C139 (= C156) binding
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
33% identity, 94% coverage: 6:173/179 of query aligns to 4:154/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G46), H44 (≠ I47)
- binding fe2/s2 (inorganic) cluster: C40 (= C43), S43 (≠ G46), C45 (= C48), G46 (≠ H49), C48 (= C51), C60 (= C68), C100 (= C113), G101 (≠ S114), C103 (= C116), C135 (= C154), C137 (= C156)
- binding pterin cytosine dinucleotide: Q99 (= Q112), C137 (= C156)
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
33% identity, 94% coverage: 6:173/179 of query aligns to 4:154/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G46), H44 (≠ I47)
- binding fe2/s2 (inorganic) cluster: I38 (≠ L41), G39 (= G42), C40 (= C43), S43 (≠ G46), C45 (= C48), G46 (≠ H49), C48 (= C51), C60 (= C68), C100 (= C113), G101 (≠ S114), C103 (= C116), C135 (= C154), C137 (= C156)
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
32% identity, 95% coverage: 1:170/179 of query aligns to 1:152/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ Q45), G45 (= G46), E46 (≠ I47)
- binding fe2/s2 (inorganic) cluster: E40 (≠ L41), C42 (= C43), S43 (≠ G44), G45 (= G46), C47 (= C48), G48 (≠ H49), C50 (= C51), C62 (= C68), Q100 (= Q112), C101 (= C113), G102 (≠ S114), C104 (= C116), C136 (= C154), C138 (= C156)
- binding pterin cytosine dinucleotide: Q100 (= Q112), C138 (= C156)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
32% identity, 95% coverage: 1:170/179 of query aligns to 1:152/157 of Q0QLF3
- C42 (= C43) binding
- C47 (= C48) binding
- C50 (= C51) binding
- C62 (= C68) binding
- C101 (= C113) binding
- C104 (= C116) binding
- C136 (= C154) binding
- C138 (= C156) binding
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
31% identity, 87% coverage: 6:160/179 of query aligns to 3:140/450 of 1jroA
- binding flavin-adenine dinucleotide: G42 (= G46), D43 (≠ I47)
- binding fe2/s2 (inorganic) cluster: E37 (≠ L41), G38 (= G42), C39 (= C43), N40 (≠ G44), G42 (= G46), C44 (= C48), G45 (≠ H49), C47 (= C51), C63 (= C68), C103 (= C113), C106 (= C116), C134 (= C154), C136 (= C156)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 189, 191, 192, 193, 194, 195, 196, 258, 259, 268, 271, 272, 274, 280, 281, 318, 324
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
32% identity, 75% coverage: 26:160/179 of query aligns to 23:140/450 of 2w54A
- binding flavin-adenine dinucleotide: G42 (= G46)
- binding fe2/s2 (inorganic) cluster: G38 (= G42), C39 (= C43), N40 (≠ G44), G42 (= G46), C44 (= C48), G45 (≠ H49), C47 (= C51), C63 (= C68), C103 (= C113), G104 (≠ S114), C106 (= C116), C134 (= C154), R135 (= R155), C136 (= C156)
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: Q102 (= Q112), C136 (= C156)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 189, 191, 192, 193, 194, 195, 196, 199, 213, 258, 259, 267, 268, 271, 272, 274, 275, 280, 281, 318, 324, 347
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
33% identity, 85% coverage: 8:159/179 of query aligns to 6:142/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L41), G39 (= G42), C40 (= C43), G41 (= G44), G43 (= G46), Q44 (≠ I47), C45 (= C48), G46 (≠ H49), C48 (= C51), R58 (= R66), C60 (= C68), C100 (= C113), G101 (≠ S114), C103 (= C116), C137 (= C154), C139 (= C156)
- binding pterin cytosine dinucleotide: Q99 (= Q112), C139 (= C156)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
8gy3B Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 92% coverage: 7:171/179 of query aligns to 4:149/154 of 8gy3B
- binding fe2/s2 (inorganic) cluster: G38 (= G42), C39 (= C43), G40 (= G44), G42 (= G46), C44 (= C48), G45 (≠ H49), C47 (= C51), C59 (= C68), C97 (= C113), C100 (= C116), Q101 (≠ A117), C132 (= C154), C134 (= C156)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q96 (= Q112), C134 (= C156)
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
28% identity, 90% coverage: 5:165/179 of query aligns to 11:168/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G42), C48 (= C43), D49 (≠ G44), G51 (= G46), C53 (= C48), G54 (≠ H49), C56 (= C51), C68 (= C68), C107 (= C113), G108 (≠ S114), C110 (= C116), C157 (= C154), C159 (= C156)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
28% identity, 90% coverage: 5:165/179 of query aligns to 62:219/229 of P77165
- C99 (= C43) binding
- C104 (= C48) binding
- G105 (≠ H49) binding
- C107 (= C51) binding
- C119 (= C68) binding
- C158 (= C113) binding
- C161 (= C116) binding
- C208 (= C154) binding
- C210 (= C156) binding
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
30% identity, 94% coverage: 6:173/179 of query aligns to 4:153/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ L41), C40 (= C43), S43 (≠ G46), C45 (= C48), G46 (≠ H49), C48 (= C51), C60 (= C68), C99 (= C113), G100 (≠ S114), C102 (= C116), C134 (= C154), C136 (= C156)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q112), C136 (= C156)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
30% identity, 94% coverage: 6:173/179 of query aligns to 5:154/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C43), S44 (≠ G46), H45 (≠ I47), C46 (= C48), G47 (≠ H49), C49 (= C51), C61 (= C68), C100 (= C113), G101 (≠ S114), C103 (= C116), C135 (= C154), C137 (= C156)
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 83% coverage: 20:167/179 of query aligns to 28:172/1361 of Q8GUQ8
Sites not aligning to the query:
- 364 W→A: Decreases activity 8-fold.
- 421 Y→A: Decreases activity 4-fold.
- 831 E→A: Loss of activity.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
G3X982 Aldehyde oxidase 3; Aldehyde oxidase homolog 1; Azaheterocycle hydroxylase 3; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
30% identity, 86% coverage: 6:159/179 of query aligns to 10:157/1335 of G3X982
- C47 (= C43) binding
- C52 (= C48) binding
- C55 (= C51) binding
- C77 (= C68) binding
- Q116 (= Q112) binding
- C117 (= C113) binding
- C120 (= C116) binding
- C152 (= C154) binding
- C154 (= C156) binding
Sites not aligning to the query:
- 264:271 binding
- 354 binding
- 358 binding
- 367 binding
- 411 binding
- 802 binding
- 807 A→V: No effect on kinetic constants with smaller substrates like benzaldehyde or phthalazine. Decreases substrate affinity and slightly increases catalytic efficiency for bulkier substrates like phenanthridine.
- 885 Y→M: Slightly decreases substrate affinity but no effect on activity with smaller substrates like benzaldehyde or phthalazine. Increases catalytic efficiency with bulkier substrates like phenanthridine or more charged substrates like N1-methylnicotinamide.
- 889 K→H: No effect on substrate affinity but decreases catalytic efficiency for smaller substrates like benzaldehyde or phthalazine. Increases substrate affinity and activity for bulkier substrates like phenanthridine.
- 1043 binding
- 1199 binding
- 1266 E→Q: Loss of activity with different N-heterocyclic compounds as substrates. 60% reduction of activity with benzaldehyde.
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
30% identity, 86% coverage: 6:159/179 of query aligns to 4:151/1262 of 3zyvB
- binding fe2/s2 (inorganic) cluster: Y39 (≠ L41), C41 (= C43), G42 (= G44), G44 (= G46), C46 (= C48), C49 (= C51), T69 (vs. gap), C71 (= C68), C111 (= C113), G112 (≠ S114), C114 (= C116), C146 (= C154), C148 (= C156)
Sites not aligning to the query:
- active site: 716, 751, 829, 833, 861, 1207, 1208
- binding flavin-adenine dinucleotide: 227, 229, 230, 231, 232, 233, 234, 267, 303, 304, 312, 313, 316, 317, 319, 325, 326, 366, 392, 393
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
29% identity, 86% coverage: 6:159/179 of query aligns to 5:152/1225 of 3ax7A
- binding flavin-adenine dinucleotide: G45 (= G46)
- binding fe2/s2 (inorganic) cluster: G41 (= G42), C42 (= C43), G43 (= G44), G45 (= G46), C47 (= C48), G48 (≠ H49), C50 (= C51), N70 (≠ R66), C72 (= C68), C112 (= C113), G113 (≠ S114), C115 (= C116), C147 (= C154), C149 (= C156)
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: Q111 (= Q112), C149 (= C156)
Sites not aligning to the query:
- active site: 666, 701, 779, 783, 811, 1159, 1160
- binding bicarbonate ion: 738, 739, 776, 808, 809, 814, 817
- binding calcium ion: 766, 769, 770, 773, 806, 807
- binding flavin-adenine dinucleotide: 197, 198, 199, 200, 201, 202, 203, 204, 205, 278, 279, 283, 287, 288, 291, 292, 294, 295, 300, 301, 345
- binding fe2/s2 (inorganic) cluster: 643
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 695, 696, 697, 698, 810, 811, 937, 938, 939, 977, 978, 979, 981, 1093, 1160
3bdjA Crystal structure of bovine milk xanthine dehydrogenase with a covalently bound oxipurinol inhibitor (see paper)
29% identity, 86% coverage: 6:159/179 of query aligns to 4:151/1286 of 3bdjA
- binding flavin-adenine dinucleotide: E43 (≠ Q45), G44 (= G46)
- binding fe2/s2 (inorganic) cluster: G40 (= G42), C41 (= C43), G42 (= G44), G44 (= G46), C46 (= C48), G47 (≠ H49), C49 (= C51), N69 (≠ R66), C71 (= C68), Q110 (= Q112), C111 (= C113), G112 (≠ S114), C114 (= C116), C146 (= C154), C148 (= C156)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding Oxypurinol: 764, 842, 876, 971, 972, 1040, 1041, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 706
- binding Oxo(sulfanyl)molybdenum(IV) ION: 761, 872, 873, 874, 1223
Query Sequence
>AO353_27070 FitnessBrowser__pseudo3_N2E3:AO353_27070
MANCPLQMTLNGQSVGPVEVPDDLPMIDYLHEYRNLTGSRLGCGQGICHACVVIVDNPDG
TSEEVRTCITGAHYFEGKKVRTIEGHARRDESGKVTELTPIQQRFVDEFAFQCSYCAPGF
VNAATVLVEKLQRQPISKSQLEAVIEDSLGHHICRCTGYVRYYSATRHVLTDLGLVKEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory