SitesBLAST
Comparing AO353_27485 FitnessBrowser__pseudo3_N2E3:AO353_27485 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 85% coverage: 33:398/429 of query aligns to 25:382/383 of 5i39A
- active site: F66 (≠ N74), Q69 (= Q77), A70 (= A78), Q248 (≠ G260), P267 (= P279)
- binding flavin-adenine dinucleotide: V30 (≠ I38), G31 (= G39), G33 (= G41), I34 (≠ F42), L35 (≠ S43), V53 (≠ L61), E54 (= E62), K55 (≠ A63), Q62 (≠ A70), S63 (= S71), F66 (≠ N74), Y67 (≠ G75), Q69 (= Q77), A196 (≠ K212), A197 (= A213), G226 (vs. gap), G227 (vs. gap), W229 (vs. gap), Q248 (≠ G260), Q250 (≠ Y262), G321 (= G344), M323 (≠ I346), T348 (≠ S369), G349 (= G370), W350 (≠ H371), G351 (= G372), M352 (≠ V373), T353 (≠ L374)
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 64% coverage: 33:305/429 of query aligns to 50:310/866 of Q9UI17
- CV 59:60 (≠ FS 42:43) binding
- EK 80:81 (≠ EA 62:63) binding
- 87:95 (vs. 68:73, 33% identical) binding
- H91 (≠ A69) modified: Tele-8alpha-FAD histidine
- H109 (≠ Y95) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (≠ A213) binding
- S279 (≠ E272) to P: in dbSNP:rs532964
Sites not aligning to the query:
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 64% coverage: 33:305/429 of query aligns to 43:303/857 of Q63342
- CV 52:53 (≠ FS 42:43) binding
- EK 73:74 (≠ EA 62:63) binding
- 80:88 (vs. 68:73, 33% identical) binding
- H84 (≠ A69) modified: Tele-8alpha-FAD histidine
- V212 (≠ A213) binding
- W244 (≠ Y244) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
25% identity, 64% coverage: 33:305/429 of query aligns to 6:266/824 of 4pabB
- active site: T53 (≠ S83), E102 (= E144), H226 (≠ T261), Y255 (≠ F294)
- binding flavin-adenine dinucleotide: I11 (= I38), G12 (= G39), G14 (= G41), C15 (≠ F42), V16 (≠ S43), L35 (= L61), E36 (= E62), K37 (≠ A63), G43 (vs. gap), S44 (vs. gap), T45 (vs. gap), H47 (≠ A69), A48 (= A70), A49 (≠ S71), G50 (= G72), L51 (≠ R73), V175 (≠ A213), A204 (≠ C241), G205 (≠ N242), W207 (≠ Y244), H226 (≠ T261), Y228 (≠ Q263)
Sites not aligning to the query:
- active site: 536
- binding flavin-adenine dinucleotide: 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
27% identity, 48% coverage: 33:240/429 of query aligns to 17:217/433 of 5hxwA
- active site: F58 (≠ N74), Q61 (= Q77), A62 (= A78)
- binding flavin-adenine dinucleotide: V22 (≠ I38), G23 (= G39), G25 (= G41), I26 (≠ F42), L27 (≠ S43), E46 (= E62), K47 (≠ A63), E53 (≠ A69), Q54 (≠ A70), S55 (= S71), R57 (= R73), F58 (≠ N74), Y59 (≠ G75), G60 (= G76), Q61 (= Q77), A188 (≠ K212), A189 (= A213)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 218, 219, 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
22% identity, 52% coverage: 163:387/429 of query aligns to 122:351/374 of 1y56B
- active site: H224 (vs. gap), P239 (≠ A276), G305 (= G344), M338 (≠ L374)
- binding flavin-adenine dinucleotide: E170 (≠ K212), V171 (≠ A213), T200 (≠ C241), N201 (= N242), W203 (≠ Y244), G305 (= G344), Y306 (≠ H345), Y307 (≠ I346), G334 (= G370), H335 (= H371), G336 (= G372), F337 (≠ V373), M338 (≠ L374)
- binding flavin mononucleotide: I260 (≠ D299), R301 (≠ F340), W303 (= W342)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
Query Sequence
>AO353_27485 FitnessBrowser__pseudo3_N2E3:AO353_27485
MFQQSSQHVASYYAHSCADRLLSRAVLEGEHTAEVLIIGAGFSGLHTALRLALAGKRVTL
LEASRVAWAASGRNGGQAILGWSCDMPPLETALGYERARRLWDGMRWAAQELRGLPARHG
FDCDYRPGHLWTSVMPRRVSLLTEWQREASHKWGHDGLQFITREQLPQWVASERYQAGLY
DPEGGHLNPLKLALGLAAAIERAGGCIFEQSKALSYREEGDQYRVTTERGSIRANVLVLA
CNAYLDQLDPELASCVLPVGTYQVATAPLTAEQASALLPSNVCVTDNQFVLDYFRRTPDN
RLLFGGGCTYLGGMPKDIAAATRPYLERVFPQLKGVELEFAWGGHIDLTLKRTPDIGRRG
DLYWLQGYSGHGVLPTLAGARAVSDAILGQPDELALYQCLRNDSFPGGKYLAAPLEAIGK
AWYRLRDSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory