SitesBLAST
Comparing AO353_28025 FitnessBrowser__pseudo3_N2E3:AO353_28025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6c49A Crystal structure of alcohol dehydrogenase from acinetobacter baumannii
50% identity, 98% coverage: 8:342/343 of query aligns to 2:335/338 of 6c49A
7bu3A Structure of alcohol dehydrogenase yjgb in complex with NADP from escherichia coli (see paper)
50% identity, 96% coverage: 13:341/343 of query aligns to 6:336/336 of 7bu3A
- binding aspartic acid: S314 (= S319), A336 (= A341)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C40 (= C47), H41 (= H48), S42 (= S49), W51 (= W58), C151 (= C156), T155 (= T160), G175 (= G180), I176 (= I181), G177 (= G182), G178 (= G183), L179 (= L184), S198 (≠ T203), S199 (= S204), K203 (= K208), T237 (= T242), V238 (≠ A243), V240 (≠ A245), V260 (= V265), G261 (= G266), A285 (≠ P290), T286 (≠ V291), R331 (= R336)
- binding zinc ion: C40 (= C47), H62 (= H69), E63 (= E70), C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114), C151 (= C156)
7bu2B Structure of alcohol dehydrogenase yjgb from escherichia coli (see paper)
50% identity, 96% coverage: 13:342/343 of query aligns to 5:336/339 of 7bu2B
P0CH37 NADP-dependent alcohol dehydrogenase C 2; Ms-ADHC 2; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 98% coverage: 7:342/343 of query aligns to 1:345/349 of P0CH37
- K210 (≠ S207) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH36 NADP-dependent alcohol dehydrogenase C 1; Ms-ADHC 1; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 98% coverage: 7:342/343 of query aligns to 1:345/349 of P0CH36
- K210 (≠ S207) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WQC5 NADP-dependent alcohol dehydrogenase C; EC 1.1.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 98% coverage: 7:342/343 of query aligns to 1:344/346 of P9WQC5
- K209 (≠ S207) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1yqdA Sinapyl alcohol dehydrogenase complexed with NADP+ (see paper)
34% identity, 96% coverage: 12:340/343 of query aligns to 12:349/359 of 1yqdA
- active site: C47 (= C47), H48 (= H48), S49 (= S49), H52 (≠ S52), H69 (= H69), E70 (= E70), C100 (= C100), C103 (= C103), C106 (= C106), C114 (= C114), I118 (≠ Q118), C163 (= C156), T167 (= T160), R345 (= R336)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C47 (= C47), H48 (= H48), S49 (= S49), H52 (≠ S52), C163 (= C156), T167 (= T160), G188 (= G180), L189 (≠ I181), G190 (= G182), G191 (= G183), L192 (= L184), S211 (≠ T203), T212 (≠ S204), S213 (= S205), K216 (= K208), T251 (= T242), V252 (≠ A243), S253 (≠ N244), V274 (= V265), G275 (= G266), A276 (= A267), G299 (≠ P290), I300 (≠ V291), N340 (≠ G331), R345 (= R336)
- binding zinc ion: C47 (= C47), H69 (= H69), C100 (= C100), C103 (= C103), C106 (= C106), C114 (= C114), C163 (= C156)
5z0cA Nerol dehydrogenase from persicaria minor (see paper)
36% identity, 96% coverage: 12:340/343 of query aligns to 9:346/367 of 5z0cA
- active site: C44 (= C47), S46 (= S49), H49 (≠ S52), H66 (= H69), C160 (= C156)
- binding zinc ion: C44 (= C47), H66 (= H69), C97 (= C100), C100 (= C103), C103 (= C106), C111 (= C114), C160 (= C156)
7cguA Crystal structure of abhar
36% identity, 96% coverage: 12:340/343 of query aligns to 6:344/352 of 7cguA
6k3gB Crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with NADP+ (see paper)
35% identity, 97% coverage: 12:342/343 of query aligns to 12:351/356 of 6k3gB
- active site: C47 (= C47), S49 (= S49), H52 (≠ S52), H69 (= H69), C163 (= C156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H48 (= H48), S49 (= S49), H52 (≠ S52), W58 (= W58), C163 (= C156), T167 (= T160), G188 (= G180), L189 (≠ I181), G190 (= G182), G191 (= G183), L192 (= L184), S211 (≠ T203), T212 (≠ S204), S213 (= S205), K216 (= K208), T251 (= T242), V252 (≠ A243), S253 (≠ N244), A254 (= A245), V274 (= V265), G275 (= G266), A276 (= A267), A299 (≠ P290), I300 (≠ V291), R345 (= R336)
- binding zinc ion: C47 (= C47), H69 (= H69), C100 (= C100), C103 (= C103), C106 (= C106), C114 (= C114), C163 (= C156)
5vktA Cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) Moench (see paper)
36% identity, 97% coverage: 12:342/343 of query aligns to 5:346/353 of 5vktA
- active site: C40 (= C47), H41 (= H48), T42 (≠ S49), H45 (≠ S52), H62 (= H69), E63 (= E70), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114), V111 (≠ Q118), C158 (= C156), T162 (= T160), R340 (= R336)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C40 (= C47), H41 (= H48), T42 (≠ S49), H45 (≠ S52), C158 (= C156), T162 (= T160), G183 (= G180), L184 (≠ I181), G185 (= G182), G186 (= G183), L187 (= L184), S206 (≠ T203), S207 (= S204), S208 (= S205), K211 (= K208), T246 (= T242), V247 (≠ A243), S248 (≠ N244), A249 (= A245), V269 (= V265), G270 (= G266), N293 (≠ S289), G294 (≠ P290), N335 (≠ G331), R340 (= R336)
- binding zinc ion: C40 (= C47), H62 (= H69), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114), C158 (= C156)
1uufA Crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
33% identity, 97% coverage: 7:340/343 of query aligns to 1:334/339 of 1uufA
- active site: C38 (= C47), H39 (= H48), S40 (= S49), H43 (≠ S52), H60 (= H69), E61 (= E70), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), T109 (≠ Q118), C156 (= C156), T160 (= T160), R330 (= R336)
- binding zinc ion: C38 (= C47), H60 (= H69), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), C156 (= C156)
Sites not aligning to the query:
5fi3A Heteroyohimbine synthase thas1 from catharanthus roseus - complex with NADP+ (see paper)
33% identity, 96% coverage: 12:340/343 of query aligns to 8:337/344 of 5fi3A
- active site: C43 (= C47), Q44 (≠ H48), Y45 (≠ S49), E48 (≠ S52), H65 (= H69), E66 (= E70), C96 (= C100), C99 (= C103), C102 (= C106), C110 (= C114), G114 (= G115), C151 (= C156), R333 (= R336)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Q44 (≠ H48), E48 (≠ S52), T155 (= T160), G176 (= G180), L177 (≠ I181), G178 (= G182), G179 (= G183), L180 (= L184), S199 (≠ T203), S200 (= S204), K204 (= K208), T239 (= T242), I240 (≠ A243), P241 (≠ N244), L262 (≠ V265), G263 (= G266), T287 (≠ P290), S328 (≠ G331)
- binding zinc ion: C43 (= C47), H65 (= H69), E66 (= E70), C96 (= C100), C99 (= C103), C102 (= C106), C110 (= C114), C151 (= C156)
8a3nB Geissoschizine synthase from catharanthus roseus - binary complex with NADP+ (see paper)
30% identity, 96% coverage: 11:340/343 of query aligns to 8:344/352 of 8a3nB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N45 (≠ H48), V161 (≠ T160), G182 (= G180), L183 (≠ I181), L186 (= L184), S205 (≠ T203), T206 (≠ S204), K210 (= K208), T245 (≠ V241), P247 (≠ A243), V269 (= V265), A271 (= A267), S294 (≠ P290), L335 (≠ G331), R340 (= R336)
- binding zinc ion: C44 (= C47), H66 (= H69), E67 (= E70), C97 (= C100), C100 (= C103), C103 (= C106), C111 (= C114), C157 (= C156)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
33% identity, 93% coverage: 21:339/343 of query aligns to 12:334/337 of P12311
- C38 (= C47) mutation to S: No activity.
- T40 (≠ S49) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (≠ S52) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
33% identity, 93% coverage: 22:339/343 of query aligns to 13:334/336 of 6iqdA
- active site: C38 (= C47), T40 (≠ S49), H43 (≠ S52), H61 (= H69), C148 (= C156)
- binding zinc ion: C38 (= C47), H61 (= H69), E62 (= E70), C92 (= C100), C95 (= C103), C98 (= C106), C106 (= C114), C148 (= C156)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
34% identity, 91% coverage: 29:340/343 of query aligns to 25:339/341 of 3meqA
- active site: C40 (= C47), H41 (= H48), T42 (≠ S49), H45 (≠ S52), H63 (= H69), E64 (= E70), C94 (= C100), C97 (= C103), C100 (= C106), C108 (= C114), L112 (≠ Q118), C150 (= C156), T154 (= T160), R335 (= R336)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C47), H41 (= H48), T42 (≠ S49), H45 (≠ S52), C150 (= C156), T154 (= T160), G176 (= G182), G177 (= G183), L178 (= L184), D197 (≠ T203), I198 (≠ S204), K202 (= K208), T241 (= T242), A242 (= A243), V243 (≠ N244), S244 (≠ A245), A247 (≠ D248), N264 (≠ V265), G265 (= G266), L266 (≠ A267), I289 (≠ P290), V290 (= V291)
- binding zinc ion: C40 (= C47), H63 (= H69), C94 (= C100), C97 (= C103), C100 (= C106), C108 (= C114), C150 (= C156)
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
32% identity, 93% coverage: 21:339/343 of query aligns to 12:334/339 of 1rjwA
- active site: C38 (= C47), H39 (= H48), T40 (≠ S49), H43 (≠ S52), H61 (= H69), E62 (= E70), C92 (= C100), C95 (= C103), C98 (= C106), C106 (= C114), K110 (≠ Q118), C148 (= C156), T152 (= T160), R331 (= R336)
- binding trifluoroethanol: T40 (≠ S49), C148 (= C156), I285 (≠ P290)
- binding zinc ion: C38 (= C47), H61 (= H69), C92 (= C100), C95 (= C103), C98 (= C106), C106 (= C114)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
33% identity, 94% coverage: 19:340/343 of query aligns to 10:335/338 of Q8GIX7
- C38 (= C47) binding
- H61 (= H69) binding
- E62 (= E70) binding
- C92 (= C100) binding
- C95 (= C103) binding
- C98 (= C106) binding
- C106 (= C114) binding
- C148 (= C156) binding
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
31% identity, 93% coverage: 21:339/343 of query aligns to 12:334/337 of 3piiA
- active site: C38 (= C47), H39 (= H48), T40 (≠ S49), H43 (≠ S52), H61 (= H69), E62 (= E70), C92 (= C100), C95 (= C103), C98 (= C106), C106 (= C114), K110 (≠ Q118), C148 (= C156), T152 (= T160), R331 (= R336)
- binding butyramide: T40 (≠ S49), H61 (= H69), W87 (= W95), C148 (= C156)
- binding zinc ion: C38 (= C47), H61 (= H69), E62 (= E70), C92 (= C100), C95 (= C103), C98 (= C106), C106 (= C114), C148 (= C156)
Query Sequence
>AO353_28025 FitnessBrowser__pseudo3_N2E3:AO353_28025
MSASTELTSFTGWAATAAGAPLERYSYDPGPLGEEEVEVAVEYCGVCHSDQSLIDNEWGI
SQYPFIPGHEVVGSIVRVGTQVRGLEVGQRVGIGWYKGSCMHCSSCIGGSHHLCGTVQPT
IVGSNGGFADRLRSHWAWALPIPSGLDPAMAGPLFCAGSTVFNPLVEFDVKPTDRVGVVG
IGGLGHLALRFLNAWGCEVTAFTSSLSKQDEARRLGAHNVVASTDSNALKSIAGTLDFLL
VTANADLDWPAMLGTLRGKGRLHFVGAVPGAIPVHVFNLLPQQKSLSASPVGSPSTTATM
LEFCVRHQILPQVEHFPMSRVNEAIDHLRSGKARYRIVLDASK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory