SitesBLAST
Comparing AO353_28090 FitnessBrowser__pseudo3_N2E3:AO353_28090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9JII6 Aldo-keto reductase family 1 member A1; Alcohol dehydrogenase [NADP(+)]; Aldehyde reductase; Glucuronate reductase; Glucuronolactone reductase; EC 1.1.1.2; EC 1.1.1.372; EC 1.1.1.54; EC 1.1.1.19; EC 1.1.1.20 from Mus musculus (Mouse)
42% identity, 83% coverage: 17:279/316 of query aligns to 7:276/325 of Q9JII6
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
P51635 Aldo-keto reductase family 1 member A1; 3-DG-reducing enzyme; Alcohol dehydrogenase [NADP(+)]; Aldehyde reductase; Glucuronate reductase; Glucuronolactone reductase; EC 1.1.1.2; EC 1.1.1.372; EC 1.1.1.54; EC 1.1.1.19; EC 1.1.1.20 from Rattus norvegicus (Rat) (see paper)
42% identity, 83% coverage: 17:279/316 of query aligns to 7:276/325 of P51635
- K13 (≠ A23) Not glycated
- K23 (≠ F33) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K30 (≠ T40) Not glycated
- K34 (= K44) Not glycated
- K61 (= K71) Not glycated
- K68 (= K78) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K80 (= K89) Not glycated
- K85 (≠ N94) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K97 (≠ A106) Not glycated
- K127 (≠ R136) Not glycated
- K134 (≠ I143) Not glycated
- K141 (≠ I151) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K145 (≠ R155) Not glycated
- K153 (≠ E163) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K157 (= K167) Not glycated
- K240 (≠ R243) Not glycated
- K257 (≠ G260) Not glycated
- K263 (≠ T266) Not glycated
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
- 287 Not glycated
- 294 Not glycated
- 308 Not glycated
1xf0A Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) complexed with delta4-androstene-3,17-dione and NADP (see paper)
42% identity, 81% coverage: 24:279/316 of query aligns to 12:276/316 of 1xf0A
- active site: D43 (= D55), Y48 (= Y60), K77 (= K89), H110 (= H122)
- binding 4-androstene-3-17-dione: M113 (≠ F125), N160 (≠ D173), W220 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G30), Y20 (≠ L32), D43 (= D55), Y48 (= Y60), H110 (= H122), N160 (≠ D173), Q183 (= Q194), Y209 (≠ F220), S210 (≠ A221), L212 (= L223), S214 (≠ H225), Q215 (≠ G226), L229 (= L232), A246 (= A249), L261 (= L264), K263 (≠ T266), S264 (= S267), R269 (≠ H272), Q272 (≠ E275), N273 (= N276)
Sites not aligning to the query:
P14550 Aldo-keto reductase family 1 member A1; Alcohol dehydrogenase [NADP(+)]; Aldehyde reductase; Glucuronate reductase; Glucuronolactone reductase; EC 1.1.1.2; EC 1.1.1.372; EC 1.1.1.54; EC 1.1.1.19; EC 1.1.1.20 from Homo sapiens (Human) (see 3 papers)
42% identity, 83% coverage: 17:279/316 of query aligns to 7:276/325 of P14550
- Y50 (= Y60) active site, Proton donor; mutation to F: Complete loss of enzymatic activity.; mutation to H: Complete loss of enzymatic activity.
- N52 (= N62) to S: reduced activity towards daunorubicin; dbSNP:rs2229540
- E55 (≠ K65) to D: reduced activity towards daunorubicin; dbSNP:rs6690497
- K80 (= K89) Lowers pKa of active site Tyr; mutation to M: Complete loss of enzymatic activity.
- H113 (= H122) binding ; mutation to Q: Strong decrease in enzymatic activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 299 I→A: No change in enzymatic activity.; I→C: No change in enzymatic activity.
- 300 V→C: No change in enzymatic activity.
3uzxB Crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with NADP+ and epiandrosterone (see paper)
41% identity, 91% coverage: 14:300/316 of query aligns to 8:307/325 of 3uzxB
- active site: D52 (= D55), Y57 (= Y60), K86 (= K89), H119 (= H122)
- binding (3Beta,5alpha)-3-Hydroxyandrostan-17-one: Y25 (≠ L32), Y57 (= Y60), H119 (= H122), Y131 (≠ E134), W229 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G30), T24 (= T31), Y25 (≠ L32), D52 (= D55), Y57 (= Y60), H119 (= H122), Q192 (= Q194), Y218 (≠ F220), S219 (≠ A221), P220 (= P222), L221 (= L223), T223 (≠ H225), S224 (≠ G226), L238 (= L232), A255 (= A249), I270 (≠ L264), P271 (≠ T265), K272 (≠ T266), S273 (= S267), R278 (≠ H272), E281 (= E275), N282 (= N276)
3uzxA Crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with NADP+ and epiandrosterone (see paper)
41% identity, 91% coverage: 14:300/316 of query aligns to 8:307/325 of 3uzxA
- active site: D52 (= D55), Y57 (= Y60), K86 (= K89), H119 (= H122)
- binding 5-alpha-androstane-3-beta,17beta-diol: Y25 (≠ L32), Y57 (= Y60), H119 (= H122), Y131 (≠ E134), W229 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G30), T24 (= T31), Y25 (≠ L32), D52 (= D55), Y57 (= Y60), H119 (= H122), Q192 (= Q194), Y218 (≠ F220), S219 (≠ A221), P220 (= P222), L221 (= L223), T223 (≠ H225), A255 (= A249), I270 (≠ L264), P271 (≠ T265), K272 (≠ T266), S273 (= S267), R278 (≠ H272), E281 (= E275), N282 (= N276)
P80508 Prostaglandin-E(2) 9-reductase; 20-alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; EC 1.1.1.189; EC 1.1.1.149 from Oryctolagus cuniculus (Rabbit) (see paper)
41% identity, 91% coverage: 12:300/316 of query aligns to 2:305/323 of P80508
- TY 23:24 (≠ TL 31:32) binding
- D50 (= D55) binding
- F54 (≠ R59) mutation to L: 49% reduction in 20alpha-HSD activity; little effect on 3-alpha-HSD.; mutation to V: 73% reduction in 20alpha-HSD activity; little effect on 3-alpha-HSD.
- SN 166:167 (≠ SD 172:173) binding
- Q190 (= Q194) binding
- YSALGS 216:221 (≠ FAPLGH 220:225) binding
- 270:280 (vs. 266:276, 45% identical) binding
Sites not aligning to the query:
- 306 V→F: Greatly reduced 3alpha-HSD activity toward DHT; little effect on 20alpha-HSD activity.
1q5mA Binary complex of rabbit 20alpha-hydroxysteroid dehydrogenase with NADPH (see paper)
41% identity, 91% coverage: 12:300/316 of query aligns to 1:304/322 of 1q5mA
- active site: D49 (= D55), Y54 (= Y60), K83 (= K89), H116 (= H122)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G30), T22 (= T31), Y23 (≠ L32), D49 (= D55), Y54 (= Y60), H116 (= H122), Q189 (= Q194), Y215 (≠ F220), S216 (≠ A221), L218 (= L223), S220 (≠ H225), H221 (≠ G226), A252 (= A249), L267 (= L264), K269 (≠ T266), S270 (= S267), F271 (≠ A268), T272 (= T269), R275 (≠ H272), E278 (= E275), N279 (= N276)
1q13A Crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with NADP and testosterone (see paper)
41% identity, 91% coverage: 12:300/316 of query aligns to 1:304/322 of 1q13A
- active site: D49 (= D55), Y54 (= Y60), K83 (= K89), H116 (= H122)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G30), T22 (= T31), Y23 (≠ L32), D49 (= D55), Y54 (= Y60), H116 (= H122), Q189 (= Q194), Y215 (≠ F220), S216 (≠ A221), L218 (= L223), S220 (≠ H225), H221 (≠ G226), L235 (= L232), A252 (= A249), L267 (= L264), K269 (≠ T266), S270 (= S267), T272 (= T269), R275 (≠ H272), E278 (= E275), N279 (= N276)
- binding testosterone: Y23 (≠ L32), F53 (≠ R59), Y54 (= Y60), H116 (= H122), P224 (= P229)
3h4gA Structure of aldehyde reductase holoenzyme in complex with potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity (see paper)
39% identity, 93% coverage: 17:309/316 of query aligns to 7:307/320 of 3h4gA
- active site: D45 (= D55), Y50 (= Y60), K80 (= K89), H113 (= H122)
- binding (2s,4s)-2-aminoformyl-6-fluoro-spiro[chroman-4,4'-imidazolidine]-2',5'-dione: W22 (≠ L32), Y50 (= Y60), H113 (= H122), W114 (≠ T123), W220 (vs. gap), I299 (≠ N301), V300 (≠ S302), P301 (≠ V303)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G30), T21 (= T31), W22 (≠ L32), D45 (= D55), Y50 (= Y60), H113 (= H122), S162 (= S172), N163 (≠ D173), Q184 (= Q194), Y210 (≠ F220), S211 (≠ A221), P212 (= P222), L213 (= L223), S215 (≠ H225), D217 (vs. gap), A246 (= A249), I261 (≠ L264), P262 (≠ T265), K263 (≠ T266), S264 (= S267), V265 (≠ A268), T266 (= T269), R269 (≠ H272), Q272 (≠ E275), N273 (= N276)
4xo6B Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with NADP+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one (see paper)
38% identity, 95% coverage: 12:311/316 of query aligns to 4:319/325 of 4xo6B
- active site: D52 (= D55), Y57 (= Y60), K86 (= K89), H119 (= H122)
- binding (3Beta,5alpha)-3-Hydroxyandrostan-17-one: Y26 (≠ L32), V56 (≠ R59), I131 (≠ E134), H224 (≠ G226)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G30), T25 (= T31), Y26 (≠ L32), D52 (= D55), Y57 (= Y60), H119 (= H122), Q192 (= Q194), Y218 (≠ F220), S219 (≠ A221), L221 (= L223), S223 (≠ H225), H224 (≠ G226), A255 (= A249), L270 (= L264), K272 (≠ T266), S273 (= S267), R278 (≠ H272), Q281 (≠ E275), N282 (= N276)
4xo6A Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with NADP+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one (see paper)
38% identity, 95% coverage: 12:311/316 of query aligns to 4:319/325 of 4xo6A
- active site: D52 (= D55), Y57 (= Y60), K86 (= K89), H119 (= H122)
- binding 5alpha-androstan-3,17-dione: Y26 (≠ L32), W88 (= W91), I131 (≠ E134)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G30), T25 (= T31), Y26 (≠ L32), D52 (= D55), Y57 (= Y60), H119 (= H122), Q192 (= Q194), Y218 (≠ F220), S219 (≠ A221), L221 (= L223), S223 (≠ H225), H224 (≠ G226), A255 (= A249), L270 (= L264), K272 (≠ T266), S273 (= S267), R278 (≠ H272), Q281 (≠ E275), N282 (= N276)
4l1wA Crystal structuer of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with NADP+ and progesterone (see paper)
38% identity, 95% coverage: 12:311/316 of query aligns to 4:319/325 of 4l1wA
- active site: D52 (= D55), Y57 (= Y60), K86 (= K89), H119 (= H122)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G30), T25 (= T31), Y26 (≠ L32), D52 (= D55), Y57 (= Y60), H119 (= H122), Q192 (= Q194), Y218 (≠ F220), S219 (≠ A221), L221 (= L223), S223 (≠ H225), H224 (≠ G226), A255 (= A249), L270 (= L264), K272 (≠ T266), S273 (= S267), R278 (≠ H272), Q281 (≠ E275), N282 (= N276)
- binding progesterone: Y26 (≠ L32), V130 (≠ Q133), I131 (≠ E134), W229 (vs. gap), L310 (≠ V303)
1xjbA Crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with NADP(h), citrate and acetate molecules (see paper)
38% identity, 95% coverage: 12:311/316 of query aligns to 4:319/325 of 1xjbA
- active site: D52 (= D55), Y57 (= Y60), K86 (= K89), H119 (= H122)
- binding acetate ion: P19 (= P25), L21 (≠ V27), Y57 (= Y60), H119 (= H122), F286 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G30), T25 (= T31), Y26 (≠ L32), D52 (= D55), Y57 (= Y60), H119 (= H122), N169 (≠ D173), Q192 (= Q194), Y218 (≠ F220), S219 (≠ A221), L221 (= L223), S223 (≠ H225), H224 (≠ G226), L238 (= L232), A255 (= A249), L270 (= L264), A271 (≠ T265), K272 (≠ T266), S273 (= S267), R278 (≠ H272), Q281 (≠ E275), N282 (= N276)
3cv7A Crystal structure of porcine aldehyde reductase ternary complex (see paper)
41% identity, 83% coverage: 17:279/316 of query aligns to 7:276/322 of 3cv7A
- active site: D45 (= D55), Y50 (= Y60), K80 (= K89), H113 (= H122)
- binding 3,5-dichloro-2-hydroxybenzoic acid: W22 (≠ L32), Y50 (= Y60), W82 (= W91), H113 (= H122)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G30), T21 (= T31), W22 (≠ L32), Y50 (= Y60), H113 (= H122), Q184 (= Q194), Y210 (≠ F220), S211 (≠ A221), P212 (= P222), L213 (= L223), S215 (≠ H225), A246 (= A249), I261 (≠ L264), P262 (≠ T265), K263 (≠ T266), S264 (= S267), V265 (≠ A268), T266 (= T269), R269 (≠ H272), Q272 (≠ E275), N273 (= N276)
Sites not aligning to the query:
3fx4A Porcine aldehyde reductase in ternary complex with inhibitor (see paper)
41% identity, 83% coverage: 17:279/316 of query aligns to 7:276/325 of 3fx4A
- active site: D45 (= D55), Y50 (= Y60), K80 (= K89), H113 (= H122)
- binding [(5Z)-5-{[3-(carboxymethoxy)-4-methoxyphenyl]methylidene}-2,4-dioxo-1,3-thiazolidin-3-yl]acetic acid: W22 (≠ L32), Y50 (= Y60), H113 (= H122), R218 (vs. gap), A219 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G30), T21 (= T31), W22 (≠ L32), D45 (= D55), Y50 (= Y60), H113 (= H122), Q184 (= Q194), Y210 (≠ F220), S211 (≠ A221), P212 (= P222), L213 (= L223), S215 (≠ H225), A246 (= A249), I261 (≠ L264), P262 (≠ T265), K263 (≠ T266), S264 (= S267), V265 (≠ A268), T266 (= T269), R269 (≠ H272), Q272 (≠ E275), N273 (= N276)
Sites not aligning to the query:
P50578 Aldo-keto reductase family 1 member A1; Alcohol dehydrogenase [NADP(+)]; Aldehyde reductase; Glucuronate reductase; Glucuronolactone reductase; EC 1.1.1.2; EC 1.1.1.372; EC 1.1.1.54; EC 1.1.1.19; EC 1.1.1.20 from Sus scrofa (Pig) (see paper)
41% identity, 83% coverage: 17:279/316 of query aligns to 7:276/325 of P50578
- Y50 (= Y60) active site, Proton donor
- H113 (= H122) binding
- 211:273 (vs. 221:276, 35% identical) binding
4xo7A Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with NADP+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one (see paper)
38% identity, 95% coverage: 12:311/316 of query aligns to 1:316/322 of 4xo7A
- active site: D49 (= D55), Y54 (= Y60), K83 (= K89), H116 (= H122)
- binding 4-androstene-3-17-dione: Y23 (≠ L32), V127 (≠ Q133), I128 (≠ E134), H221 (≠ G226), W226 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G30), T22 (= T31), Y23 (≠ L32), D49 (= D55), Y54 (= Y60), H116 (= H122), S165 (= S172), N166 (≠ D173), Q189 (= Q194), Y215 (≠ F220), S216 (≠ A221), L218 (= L223), S220 (≠ H225), H221 (≠ G226), A252 (= A249), L267 (= L264), K269 (≠ T266), S270 (= S267), R275 (≠ H272), Q278 (≠ E275), N279 (= N276)
2hdjA Crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with NADP(h) (see paper)
38% identity, 95% coverage: 12:311/316 of query aligns to 1:316/322 of 2hdjA
- active site: D49 (= D55), Y54 (= Y60), K83 (= K89), H116 (= H122)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G30), T22 (= T31), Y23 (≠ L32), D49 (= D55), Y54 (= Y60), H116 (= H122), Q189 (= Q194), Y215 (≠ F220), S216 (≠ A221), L218 (= L223), S220 (≠ H225), H221 (≠ G226), L235 (= L232), A252 (= A249), K269 (≠ T266), S270 (= S267), R275 (≠ H272), Q278 (≠ E275), N279 (= N276)
1j96A Human 3alpha-hsd type 3 in ternary complex with NADP and testosterone (see paper)
38% identity, 95% coverage: 12:311/316 of query aligns to 2:317/323 of 1j96A
- active site: D50 (= D55), Y55 (= Y60), K84 (= K89), H117 (= H122)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G30), T23 (= T31), Y24 (≠ L32), D50 (= D55), Y55 (= Y60), Q190 (= Q194), Y216 (≠ F220), S217 (≠ A221), L219 (= L223), S221 (≠ H225), H222 (≠ G226), A253 (= A249), K270 (≠ T266), S271 (= S267), R276 (≠ H272), Q279 (≠ E275), N280 (= N276), L306 (≠ N301)
- binding testosterone: Y24 (≠ L32), V128 (≠ Q133), I129 (≠ E134), W227 (vs. gap)
Query Sequence
>AO353_28090 FitnessBrowser__pseudo3_N2E3:AO353_28090
MSYEAFHDELRDTKFPLVHGSGAMPAVGFGTLFRDLSVTTQAIKHALETGFRHFDCAERY
RNEDKVGVAIKEFLETGKVRREDLFITTKLWNTNHRPERVLPAFEASCRRLQVDYIDCYL
IHTPFAFQPGEDQEPRDEQGRIIYDSGVTLIETWRALERLVDEGRCKSIGLSDITLQALQ
EIVAVARIKPAVVQVESHPYLPEWELLEFCRQHGIIVLAFAPLGHGMQPNVLEDAVITGV
ARRLQQTPAQVALAWSVQRGVAFLTTSATLSHIQENFAISTLPHRAMLEIKDDITTRVRF
NSVVETGVPGFIPGKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory