Comparing AO353_28160 FitnessBrowser__pseudo3_N2E3:AO353_28160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 95% coverage: 15:387/391 of query aligns to 48:423/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 93% coverage: 18:382/391 of query aligns to 13:371/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 95% coverage: 15:387/391 of query aligns to 52:427/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
39% identity, 86% coverage: 1:338/391 of query aligns to 5:344/398 of 6slfA
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
36% identity, 96% coverage: 3:376/391 of query aligns to 4:377/389 of 4ewtA
3ramA Crystal structure of hmra (see paper)
23% identity, 73% coverage: 3:289/391 of query aligns to 6:273/391 of 3ramA
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
25% identity, 76% coverage: 12:309/391 of query aligns to 2:305/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
25% identity, 76% coverage: 12:309/391 of query aligns to 2:305/376 of 4o23A
>AO353_28160 FitnessBrowser__pseudo3_N2E3:AO353_28160
MTQFMPLLKEIEHEMRELRHHLHANPELGYQEVETSELVAERLTRWGYAVTRGYAETAVI
ATLKKGTSPRVLGIRADMDALPILEKTGLPYASRIPGKMHACGHDGHTVMLLAAAYALAH
GHPFDGTVHLIFQPAEEGLAGARRMIQEGVLQKFPCDAVFAAHNMPGYPVGKLGFRAGPF
MASADQVNVTIHGKGGHGAMPHLSVDPVVVCASIIMALQTIVSRNVSPQDMSVITVGAIN
AGKASNVIPDSAHMLMSVRSLNNAVRDRLESQIKRLIHAQAEAFGATAEIHYSADYPLLV
NDEEMTRFASQVAIDWLGEDEVMRDIVPFNGSEDFAYFLQQCPGCYLIIGNGDGEKSCMA
HDPRYDFNDDILIRGAGYWVKLTEAFLPLNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory