SitesBLAST
Comparing AO353_28590 FitnessBrowser__pseudo3_N2E3:AO353_28590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
53% identity, 99% coverage: 4:249/249 of query aligns to 3:249/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S138), H147 (≠ F148), Y150 (= Y151), L188 (= L189), L246 (≠ A246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ T16), S16 (≠ T17), G17 (= G18), I18 (= I19), R38 (= R39), R39 (= R40), D60 (= D61), V61 (= V62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (= V111), T135 (= T136), S137 (= S138), Y150 (= Y151), K154 (= K155), P180 (= P181), G181 (= G182), A182 (≠ P183), I183 (≠ V184), T185 (= T186), S187 (≠ G188)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
53% identity, 99% coverage: 4:249/249 of query aligns to 3:249/249 of 4bmsF
- active site: S137 (= S138), H147 (≠ F148), Y150 (= Y151), K154 (= K155), Q195 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ T16), S16 (≠ T17), I18 (= I19), R38 (= R39), R39 (= R40), A59 (≠ G60), D60 (= D61), V61 (= V62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (= V111), S137 (= S138), Y150 (= Y151), K154 (= K155), G181 (= G182), I183 (≠ V184), T185 (= T186), I187 (≠ G188)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
41% identity, 97% coverage: 7:248/249 of query aligns to 5:246/251 of 4esoB
- active site: G16 (= G18), S136 (= S138), M146 (≠ F148), Y149 (= Y151), K153 (= K155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), T14 (= T16), H15 (≠ T17), M17 (≠ I19), R37 (= R39), N38 (≠ R40), N41 (≠ E43), S58 (≠ G60), D59 (= D61), I60 (≠ V62), N86 (= N88), A87 (= A89), G88 (= G90), T134 (= T136), S136 (= S138), Y149 (= Y151), P179 (= P181), G180 (= G182), I182 (≠ V184), T184 (= T186), T186 (vs. gap), K187 (vs. gap), G188 (= G188)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 98% coverage: 3:245/249 of query aligns to 7:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G14), S20 (≠ T16), K21 (≠ T17), G22 (= G18), I23 (= I19), A43 (≠ G38), S44 (≠ R39), S45 (≠ R40), G68 (= G60), D69 (= D61), V70 (= V62), N96 (= N88), S97 (≠ A89), G98 (= G90), Y100 (≠ G92), I144 (≠ T136), S146 (= S138), Y159 (= Y151), K163 (= K155), P189 (= P181), G190 (= G182), M191 (≠ P183), I192 (≠ V184), T194 (= T186), G196 (= G188), T197 (≠ L189)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S138), Y159 (= Y151), M191 (≠ P183), I202 (≠ L192)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
40% identity, 97% coverage: 4:245/249 of query aligns to 3:237/241 of 5t2uA
- active site: G17 (= G18), T135 (≠ S138), T145 (≠ F148), Y148 (= Y151), K152 (= K155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), G17 (= G18), R38 (= R39), D39 (≠ R40), R42 (≠ E43), D60 (= D61), L61 (= L65), N83 (= N88), A84 (= A89), Y87 (≠ L95), I133 (≠ T136), T135 (≠ S138), Y148 (= Y151), K152 (= K155), P178 (= P181), P180 (= P183), T181 (≠ V184), T183 (= T186), T185 (≠ V193), T186 (≠ P194)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
36% identity, 98% coverage: 4:247/249 of query aligns to 5:259/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S138), N144 (≠ T139), T145 (= T140), F153 (= F148), Y156 (= Y151), G187 (= G182), M193 (vs. gap), V197 (vs. gap), A259 (= A247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (≠ T17), I20 (= I19), A40 (vs. gap), N41 (vs. gap), S42 (vs. gap), D66 (= D61), N93 (= N88), S94 (≠ A89), L116 (≠ V111), T141 (= T136), Y156 (= Y151), K160 (= K155), P186 (= P181), G187 (= G182), G188 (≠ P183), T189 (≠ V184), T191 (= T186), M193 (vs. gap)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
38% identity, 98% coverage: 1:245/249 of query aligns to 3:248/259 of 6ci9D
- active site: G20 (= G18), S145 (= S138), Y159 (= Y151)
- binding 1-aminopropan-2-one: F97 (≠ L95), S145 (= S138), T147 (= T140), W156 (≠ F148), Y159 (= Y151), G190 (= G182)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), S18 (≠ T16), G20 (= G18), I21 (= I19), G40 (= G38), R41 (= R39), N42 (≠ R40), D66 (= D61), V67 (= V62), N93 (= N88), G95 (= G90), T143 (= T136), S145 (= S138), Y159 (= Y151), K163 (= K155), P189 (= P181), N191 (≠ P183), I192 (≠ V184), T194 (= T186), G196 (= G188), L197 (= L189)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
36% identity, 98% coverage: 4:247/249 of query aligns to 5:260/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ T139), T145 (= T140), F154 (= F148), G189 (≠ P183), V198 (vs. gap), A260 (= A247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (≠ T17), I20 (= I19), Y39 (vs. gap), A40 (vs. gap), N41 (vs. gap), S42 (vs. gap), D66 (= D61), V67 (= V62), N93 (= N88), S94 (≠ A89), L116 (≠ V111), T141 (= T136), Y157 (= Y151), K161 (= K155), P187 (= P181), T190 (≠ V184), T192 (= T186), M194 (vs. gap)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
37% identity, 97% coverage: 5:245/249 of query aligns to 8:250/262 of 3pk0B
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
36% identity, 98% coverage: 4:247/249 of query aligns to 4:259/259 of 4fj1B
- active site: G18 (= G18), S142 (= S138), N143 (≠ T139), H153 (≠ F148), Y156 (= Y151), K160 (= K155), Y201 (vs. gap)
- binding genistein: G188 (≠ P183), F194 (≠ L189), S198 (vs. gap), Y201 (vs. gap), I202 (≠ V193), M216 (≠ L201), A217 (≠ H202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), R17 (≠ T17), G18 (= G18), I19 (= I19), A39 (≠ I36), N40 (≠ T37), S41 (≠ G38), I66 (≠ V62), N92 (= N88), S93 (≠ A89), G94 (= G90), L115 (≠ V111), T140 (= T136), S142 (= S138), Y156 (= Y151), K160 (= K155), G187 (= G182), T189 (≠ V184), T191 (= T186), M193 (≠ G188)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
36% identity, 98% coverage: 4:247/249 of query aligns to 6:261/261 of 4fj0D
- active site: G20 (= G18), S144 (= S138), N145 (≠ T139), H155 (≠ F148), Y158 (= Y151), K162 (= K155), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S138), N145 (≠ T139), G190 (≠ P183), F196 (≠ L189), S200 (vs. gap), Y203 (vs. gap), A219 (≠ H202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), R19 (≠ T17), G20 (= G18), I21 (= I19), A41 (≠ I36), N42 (≠ T37), S43 (≠ G38), I68 (≠ V62), N94 (= N88), S95 (≠ A89), G96 (= G90), L117 (≠ V111), T142 (= T136), Y158 (= Y151), K162 (= K155), P188 (= P181), G189 (= G182), G190 (≠ P183), T191 (≠ V184), T193 (= T186), M195 (≠ G188)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
36% identity, 98% coverage: 4:247/249 of query aligns to 5:260/260 of 4fj2B
- active site: G19 (= G18), S143 (= S138), N144 (≠ T139), H154 (≠ F148), Y157 (= Y151), K161 (= K155), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (≠ T17), G19 (= G18), I20 (= I19), A40 (≠ I36), N41 (≠ T37), S42 (≠ G38), I67 (≠ V62), N93 (= N88), S94 (≠ A89), G95 (= G90), L116 (≠ V111), T141 (= T136), Y157 (= Y151), K161 (= K155), G188 (= G182), G189 (≠ P183), T190 (≠ V184), T192 (= T186), M194 (≠ G188)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ P183), F195 (≠ L189), V198 (≠ L192), S199 (vs. gap), Y202 (vs. gap), I203 (≠ V193), M217 (≠ L201), A218 (≠ H202)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
36% identity, 98% coverage: 4:247/249 of query aligns to 5:260/260 of 3qwiA
- active site: G19 (= G18), S143 (= S138), N144 (≠ T139), H154 (≠ F148), Y157 (= Y151), K161 (= K155), Y202 (vs. gap)
- binding Coumestrol: F149 (vs. gap), G189 (≠ P183), M194 (≠ G188), Y202 (vs. gap), I203 (≠ V193), A218 (≠ H202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (≠ T17), I20 (= I19), A40 (≠ I36), N41 (≠ T37), S42 (≠ G38), I67 (≠ V62), N93 (= N88), S94 (≠ A89), G95 (= G90), L116 (≠ V111), T141 (= T136), Y157 (= Y151), K161 (= K155), P187 (= P181), G188 (= G182), G189 (≠ P183), T190 (≠ V184), T192 (= T186), M194 (≠ G188)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
36% identity, 98% coverage: 4:247/249 of query aligns to 5:260/260 of 3qwhA
- active site: G19 (= G18), S143 (= S138), N144 (≠ T139), H154 (≠ F148), Y157 (= Y151), K161 (= K155), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ T139), F149 (vs. gap), G189 (≠ P183), F195 (≠ L189), S199 (vs. gap), Y202 (vs. gap), I203 (≠ V193), A218 (≠ H202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (≠ T17), G19 (= G18), I20 (= I19), A40 (≠ I36), N41 (≠ T37), S42 (≠ G38), D66 (= D61), I67 (≠ V62), N93 (= N88), S94 (≠ A89), G95 (= G90), L116 (≠ V111), T141 (= T136), Y157 (= Y151), K161 (= K155), P187 (= P181), G188 (= G182), G189 (≠ P183), T190 (≠ V184), T192 (= T186), M194 (≠ G188)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 97% coverage: 4:245/249 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G18), N111 (= N112), S139 (= S138), Q149 (≠ F148), Y152 (= Y151), K156 (= K155)
- binding acetoacetyl-coenzyme a: D93 (≠ M94), K98 (≠ S99), S139 (= S138), N146 (≠ T145), V147 (≠ E146), Q149 (≠ F148), Y152 (= Y151), F184 (≠ P183), M189 (≠ G188), K200 (≠ G200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ T17), G18 (= G18), I19 (= I19), D38 (≠ G38), F39 (≠ R39), V59 (≠ G60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (= G90), I90 (≠ G91), T137 (= T136), S139 (= S138), Y152 (= Y151), K156 (= K155), P182 (= P181), F184 (≠ P183), T185 (≠ V184), T187 (= T186), M189 (≠ G188)
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
36% identity, 98% coverage: 4:247/249 of query aligns to 9:264/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S138), Y161 (= Y151), G193 (≠ P183), M198 (vs. gap), F199 (vs. gap), V202 (vs. gap), S203 (vs. gap), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G14), R22 (≠ T17), G23 (= G18), I24 (= I19), Y43 (vs. gap), A44 (vs. gap), N45 (vs. gap), S46 (vs. gap), D70 (= D61), V71 (= V62), N97 (= N88), S98 (≠ A89), L120 (≠ V111), T145 (= T136), S147 (= S138), Y161 (= Y151), K165 (= K155), P191 (= P181), G192 (= G182), T194 (≠ V184), T196 (= T186), M198 (vs. gap)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
34% identity, 99% coverage: 2:247/249 of query aligns to 11:269/270 of 1ybvA
- active site: G27 (= G18), S151 (= S138), H162 (≠ F148), Y165 (= Y151), K169 (= K155), Y210 (vs. gap)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (= S138), Y165 (= Y151), G197 (≠ P183), M202 (≠ G188), Y203 (≠ L189), Y210 (vs. gap), W230 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G14), R26 (≠ T17), G27 (= G18), I28 (= I19), A48 (vs. gap), N49 (vs. gap), S50 (≠ T37), N74 (≠ D61), V75 (= V62), N101 (= N88), S102 (≠ A89), G103 (= G90), M149 (≠ T136), S151 (= S138), K169 (= K155), P195 (= P181), G197 (≠ P183), I198 (≠ V184), T200 (= T186), M202 (≠ G188)
Q12634 Tetrahydroxynaphthalene reductase; T4HN reductase; THNR; EC 1.1.1.252 from Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae) (see 2 papers)
33% identity, 99% coverage: 2:247/249 of query aligns to 24:282/283 of Q12634
- 39:63 (vs. 17:37, 32% identical) binding
- Y178 (= Y151) active site, Proton acceptor
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
34% identity, 99% coverage: 2:247/249 of query aligns to 14:272/273 of 1g0nA
- active site: G30 (= G18), S154 (= S138), H165 (≠ F148), Y168 (= Y151), K172 (= K155)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G14), R29 (≠ T17), G30 (= G18), I31 (= I19), A51 (vs. gap), N52 (vs. gap), S53 (≠ T37), V78 (= V62), N104 (= N88), S105 (≠ A89), G106 (= G90), I127 (≠ V111), M152 (≠ T136), Y168 (= Y151), K172 (= K155), P198 (= P181), G200 (≠ P183), I201 (≠ V184), T203 (= T186), M205 (≠ G188)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (= S138), Y168 (= Y151), G200 (≠ P183), M205 (≠ G188), Y206 (≠ L189), C210 (vs. gap), Y213 (vs. gap), W233 (vs. gap)
1dohA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4-nitro-inden-1-one (see paper)
34% identity, 99% coverage: 2:247/249 of query aligns to 14:272/273 of 1dohA
- active site: G30 (= G18), S154 (= S138), H165 (≠ F148), Y168 (= Y151), K172 (= K155), Y213 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G14), R29 (≠ T17), G30 (= G18), I31 (= I19), A51 (vs. gap), N52 (vs. gap), S53 (≠ T37), N77 (≠ D61), V78 (= V62), N104 (= N88), S105 (≠ A89), G106 (= G90), M152 (≠ T136), Y168 (= Y151), K172 (= K155), P198 (= P181), G200 (≠ P183), I201 (≠ V184), T203 (= T186), M205 (≠ G188)
- binding 4-nitro-inden-1-one: Y168 (= Y151), G200 (≠ P183), Y206 (≠ L189), C210 (vs. gap), Y213 (vs. gap)
Query Sequence
>AO353_28590 FitnessBrowser__pseudo3_N2E3:AO353_28590
MSNKLAGKVALVTGGTTGIGLASAQELAAQGATVFITGRRQAELDAAVTLIGEKAVGIRG
DVASLADLDRVFSHIAAQAGHLDIVFANAGGGDMLPLGSITEEHFDRIFSVNVKGLLFTV
QKALPLLKDGGSVILTASTTATQGTENFSVYSASKAAVRNFARSWLLDLKPRNIRVNAIS
PGPVATPGLAGLVPAEHLDGLHTHLASLVPMGRLGDPKEVAKAVLFLASDDSSFINGIEL
FVDGGAAQI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory