Comparing AO353_28745 FitnessBrowser__pseudo3_N2E3:AO353_28745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3h7cX Crystal structure of arabidopsis thaliana agmatine deiminase from cell free expression
40% identity, 97% coverage: 9:347/350 of query aligns to 11:368/369 of 3h7cX
Q8GWW7 Agmatine deiminase; Agmatine iminohydrolase; Protein EMBRYO DEFECTIVE 1873; EC 3.5.3.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 97% coverage: 9:347/350 of query aligns to 11:375/383 of Q8GWW7
6nicD Crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide (see paper)
39% identity, 96% coverage: 9:345/350 of query aligns to 1:359/360 of 6nicD
G7JT50 Agmatine deiminase; Agmatine iminohydrolase; MtAIH; EC 3.5.3.12 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
39% identity, 98% coverage: 3:345/350 of query aligns to 5:373/374 of G7JT50
Q837U5 Putative agmatine deiminase; Agmatine iminohydrolase; EC 3.5.3.12 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
35% identity, 97% coverage: 7:345/350 of query aligns to 11:364/365 of Q837U5
6b2wA C. Jejuni c315s agmatine deiminase with substrate bound (see paper)
23% identity, 94% coverage: 16:343/350 of query aligns to 15:328/333 of 6b2wA
6i0xB Porphyromonas gingivalis peptidylarginine deminase (ppad) mutant g231n/e232t/n235d in complex with cl-amidine. (see paper)
23% identity, 89% coverage: 15:325/350 of query aligns to 16:293/422 of 6i0xB
Sites not aligning to the query:
4ytbA Crystal structure of porphyromonas gingivalis peptidylarginine deiminase (ppad) in complex with dipeptide asp-gln. (see paper)
23% identity, 89% coverage: 15:325/350 of query aligns to 16:293/422 of 4ytbA
Sites not aligning to the query:
4ytgA Crystal structure of porphyromonas gingivalis peptidylarginine deiminase (ppad) mutant c351a in complex with dipeptide met-arg. (see paper)
24% identity, 70% coverage: 81:325/350 of query aligns to 72:293/417 of 4ytgA
Sites not aligning to the query:
>AO353_28745 FitnessBrowser__pseudo3_N2E3:AO353_28745
MQENEIQNNGWWMPAEWVRHAATWMVWPHNQALWESGWGVTLARVQEDFARVANAIGRFE
PVKMVVDPSAVASAKALCGPNIELIELAVNDSWCRDSGPSFVCHPQQGLAGVSWRFNAWG
GKSAHDLDESLARRALNHLGVACFGTPLSNEGGAIHVDGEGTLITTESVLLNPNRNPGMS
KAEMEEIFTRLLGVKKTVWLPGDPDYVTGDMTDGHVDGVCAFARPGVLLVDATHDKSSIY
AEVVRENRRALALATDAHGRPFELIDLYEATDAVDTEAEVFCASYTNFYIANNAIIMPAY
GIDADNVAAEVLAQAFPGREVVPVRINHLAHGGGGVHCITQQQPAWPLKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory