Comparing AO353_29020 FitnessBrowser__pseudo3_N2E3:AO353_29020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 96% coverage: 12:384/389 of query aligns to 5:372/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 96% coverage: 17:388/389 of query aligns to 52:427/442 of P54968
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 96% coverage: 15:388/389 of query aligns to 46:423/440 of O04373
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
40% identity, 87% coverage: 2:339/389 of query aligns to 4:344/398 of 6slfA
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
35% identity, 95% coverage: 10:377/389 of query aligns to 9:377/389 of 4ewtA
3ramA Crystal structure of hmra (see paper)
25% identity, 73% coverage: 6:290/389 of query aligns to 7:273/391 of 3ramA
Sites not aligning to the query:
7yh4A Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (pm20d2)
26% identity, 72% coverage: 20:298/389 of query aligns to 28:301/400 of 7yh4A
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
24% identity, 34% coverage: 188:319/389 of query aligns to 183:310/373 of 3rzaA
Sites not aligning to the query:
>AO353_29020 FitnessBrowser__pseudo3_N2E3:AO353_29020
MNAGHVLPGIAALQDEMITLRQRIHAHPELGFEEFSTSELVAQCLTQWGYDVSTGVGKTG
VVGTLKNGEGRSLGLRADMDALPIQEATGLPYASRIDGVMHACGHDGHTATLLAAAKYLA
QTREFNGTLNLVFQPAEEGLGGAKKMLEDGLFERFPCDAIFAMHNIPGYPAGQLGFYSGP
FMASADTVTIKVIGTGGHGAVPHKSVDPVVVCASIVIALQSIVSRNVNPQETAIITVGSI
HAGNVSNVIPASAEMILSVRALTPEVRQLLERRITDLVNGQAASFGAQAEIDYYRCHPVL
INDPEQTAFARQVAREWLGEGQLIEDLRPFTASEDFAFILEQCPGSYLVIGNGQGEGSCL
LHNPGYDFNDACLPIGASYWVKLAEGFLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory