SitesBLAST
Comparing AO353_29040 FitnessBrowser__pseudo3_N2E3:AO353_29040 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
74% identity, 97% coverage: 13:449/449 of query aligns to 8:446/446 of P0AES2
- Y150 (= Y155) mutation to F: Reduces activity 100-fold.
- K207 (= K211) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D239) binding
- E266 (= E270) binding
- N289 (= N293) binding
- H339 (= H343) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N345) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D370) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
74% identity, 97% coverage: 13:449/449 of query aligns to 6:444/444 of 1ecqA
- active site: K203 (= K209), K205 (= K211), D233 (= D239), N235 (= N241), E258 (= E264), N287 (= N293), M288 (= M294), D311 (= D317), H337 (= H343), N339 (= N345), I363 (= I369)
- binding 4-deoxyglucarate: N25 (= N32), H30 (= H37), T101 (= T108), Y148 (= Y155), F150 (= F157), K205 (= K211), D233 (= D239), N235 (= N241), N287 (= N293), H337 (= H343), S338 (= S344), N339 (= N345), H366 (= H372), R420 (= R425)
- binding magnesium ion: D233 (= D239), E258 (= E264), N287 (= N293)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
74% identity, 97% coverage: 13:449/449 of query aligns to 6:444/444 of 1ec9D
- active site: K203 (= K209), K205 (= K211), D233 (= D239), N235 (= N241), E258 (= E264), N287 (= N293), M288 (= M294), D311 (= D317), H337 (= H343), N339 (= N345), I363 (= I369)
- binding magnesium ion: D233 (= D239), E258 (= E264), N287 (= N293)
- binding xylarohydroxamate: H30 (= H37), T101 (= T108), Y148 (= Y155), F150 (= F157), K205 (= K211), D233 (= D239), N235 (= N241), N287 (= N293), H337 (= H343), S338 (= S344), N339 (= N345), H366 (= H372), R420 (= R425)
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
74% identity, 97% coverage: 13:449/449 of query aligns to 4:442/442 of 1ec8A
- active site: K201 (= K209), K203 (= K211), D231 (= D239), N233 (= N241), E256 (= E264), N285 (= N293), M286 (= M294), D309 (= D317), H335 (= H343), N337 (= N345), I361 (= I369)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N32), H28 (= H37), T99 (= T108), Y146 (= Y155), K203 (= K211), D231 (= D239), N233 (= N241), N285 (= N293), H335 (= H343), S336 (= S344), N337 (= N345), H364 (= H372), R418 (= R425)
- binding magnesium ion: D231 (= D239), E256 (= E264), N285 (= N293)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
74% identity, 97% coverage: 13:449/449 of query aligns to 5:443/443 of 1jctA
- active site: K202 (= K209), K204 (= K211), D232 (= D239), N234 (= N241), E257 (= E264), N286 (= N293), M287 (= M294), D310 (= D317), H336 (= H343), L338 (≠ N345), I362 (= I369)
- binding d-glucarate: N24 (= N32), H29 (= H37), T100 (= T108), Y147 (= Y155), F149 (= F157), K204 (= K211), D232 (= D239), N286 (= N293), S337 (= S344), R419 (= R425)
- binding magnesium ion: D232 (= D239), E257 (= E264), N286 (= N293)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
69% identity, 97% coverage: 13:447/449 of query aligns to 3:428/428 of 3p0wB
- active site: K189 (= K209), K191 (= K211), D219 (= D239), N221 (= N241), E244 (= E264), N273 (= N293), D297 (= D317), H323 (= H343), N325 (= N345)
- binding d-glucarate: H27 (= H37), Y134 (= Y155), K191 (= K211), D219 (= D239), N221 (= N241), N273 (= N293), H323 (= H343), N325 (= N345), H352 (= H372), R406 (= R425)
- binding magnesium ion: D219 (= D239), E244 (= E264), N273 (= N293)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
68% identity, 97% coverage: 13:447/449 of query aligns to 3:424/425 of 3nxlC
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
59% identity, 97% coverage: 13:448/449 of query aligns to 3:440/441 of 3nfuA
- active site: K201 (= K209), K203 (= K211), D231 (= D239), N233 (= N241), E256 (= E264), N285 (= N293), D309 (= D317), H335 (= H343), N337 (= N345)
- binding magnesium ion: D231 (= D239), N233 (= N241), E256 (= E264), D257 (= D265), N285 (= N293)
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
62% identity, 98% coverage: 12:449/449 of query aligns to 3:430/432 of 3n6hB
- active site: K189 (= K209), K191 (= K211), D219 (= D239), N221 (= N241), E244 (= E264), N273 (= N293), D297 (= D317), H323 (= H343), N325 (= N345)
- binding magnesium ion: D219 (= D239), E244 (= E264), N273 (= N293)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
62% identity, 98% coverage: 12:449/449 of query aligns to 2:426/426 of 3pfrA
- active site: K185 (= K209), K187 (= K211), D215 (= D239), N217 (= N241), E240 (= E264), N269 (= N293), D293 (= D317), H319 (= H343), N321 (= N345)
- binding d-glucarate: N22 (= N32), H27 (= H37), Y130 (= Y155), F132 (= F157), K187 (= K211), D215 (= D239), N217 (= N241), N269 (= N293), H319 (= H343), S320 (= S344), N321 (= N345), H348 (= H372)
- binding magnesium ion: D215 (= D239), E240 (= E264), N269 (= N293)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
36% identity, 95% coverage: 15:439/449 of query aligns to 6:421/427 of 4it1D
- active site: S51 (≠ V60), D54 (≠ G63), A98 (vs. gap), Y150 (= Y155), K194 (= K209), K196 (= K211), D224 (= D239), N226 (= N241), Y247 (= Y262), E249 (= E264), T271 (= T292), N272 (= N293), M273 (= M294), D296 (= D317), H323 (= H343), S324 (= S344), N325 (= N345), C349 (≠ I369), D350 (= D370)
- binding magnesium ion: D224 (= D239), E249 (= E264), N272 (= N293)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
33% identity, 96% coverage: 14:445/449 of query aligns to 12:425/427 of 3va8A
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
35% identity, 95% coverage: 14:439/449 of query aligns to 3:414/420 of 3vc6A
- active site: D52 (≠ G63), H55 (≠ I66), Y146 (= Y155), K188 (= K209), K190 (= K211), D218 (= D239), N220 (= N241), E243 (= E264), N266 (= N293), M267 (= M294), D290 (= D317), H317 (= H343), S318 (= S344), N319 (= N345), H321 (= H347), C343 (≠ I369), D344 (= D370)
- binding magnesium ion: D218 (= D239), E243 (= E264), N266 (= N293)
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
28% identity, 66% coverage: 117:411/449 of query aligns to 98:361/366 of 3dg6A
- active site: M134 (= M152), K160 (= K209), K162 (= K211), D191 (= D239), N193 (= N241), E217 (= E264), D242 (≠ K289), E243 (≠ T290), S244 (≠ A291), K266 (≠ P314), G292 (≠ N345), N293 (= N346), Q294 (≠ H347), G319 (≠ I369), E320 (≠ D370), L321 (≠ T371)
- binding magnesium ion: D191 (= D239), E217 (= E264), D242 (≠ K289)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (= M152), K160 (= K209), K162 (= K211), D191 (= D239), N193 (= N241), D242 (≠ K289), K266 (≠ P314), N293 (= N346), Q294 (≠ H347), I295 (≠ F348)
Sites not aligning to the query:
2gghC The mutant a68c-d72c-nlq of deinococcus radiodurans nacylamino acid racemase (see paper)
27% identity, 76% coverage: 77:415/449 of query aligns to 77:363/370 of 2gghC
- active site: Y95 (≠ A95), S137 (≠ R170), K163 (= K209), K165 (= K211), R186 (= R235), T188 (= T237), D190 (= D239), N192 (= N241), E215 (= E264), D240 (≠ K289), E241 (≠ T290), S242 (≠ A291), K264 (≠ A316), C290 (vs. gap), G291 (vs. gap), G292 (vs. gap), M293 (vs. gap), G316 (= G364), D317 (= D365), T318 (≠ I366)
- binding magnesium ion: D190 (= D239), E215 (= E264)
- binding n~2~-acetyl-l-glutamine: G292 (vs. gap), M293 (vs. gap), L294 (vs. gap)
Sites not aligning to the query:
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
24% identity, 82% coverage: 45:412/449 of query aligns to 29:369/373 of 3sjnA
- active site: S46 (≠ G62), L49 (≠ R65), T139 (≠ L156), K165 (= K209), G167 (≠ K211), M171 (≠ L215), D198 (= D239), A200 (≠ N241), E225 (= E264), I247 (≠ T290), G250 (≠ N293), E251 (≠ M294), S252 (≠ I295), Q272 (≠ L315), D274 (= D317), H301 (= H334), G302 (≠ E335), F303 (≠ W336), M325 (≠ T367), E326 (≠ A368), Q329 (= Q376), S331 (≠ G378)
- binding magnesium ion: D198 (= D239), E225 (= E264), E251 (≠ M294)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
23% identity, 65% coverage: 117:410/449 of query aligns to 87:345/351 of 5olcC
- active site: K148 (= K209), K150 (= K211), D178 (= D239), N180 (= N241), E204 (= E264), G229 (≠ N293), E230 (≠ A296), D253 (≠ H319), H280 (= H334), E304 (≠ D370), E309 (≠ H372)
- binding magnesium ion: D178 (= D239), E204 (= E264), E230 (≠ A296)
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
25% identity, 65% coverage: 113:406/449 of query aligns to 92:346/363 of 2og9A
- active site: T132 (≠ F157), K160 (= K209), K162 (= K211), D191 (= D239), N193 (= N241), E217 (= E264), G242 (≠ N293), E243 (≠ M294), M264 (≠ L315), D266 (= D317), H293 (= H343), F294 (≠ I350), A295 (≠ S351), E313 (≠ I369)
- binding calcium ion: A232 (≠ M279), F235 (= F282)
Sites not aligning to the query:
3ugvF Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
25% identity, 76% coverage: 70:411/449 of query aligns to 64:359/364 of 3ugvF
- active site: A95 (= A102), S137 (= S171), K168 (= K209), R170 (≠ K211), D199 (= D239), N201 (= N241), E225 (= E264), G250 (≠ A291), E251 (≠ T292), N252 (= N293), M272 (≠ L315), D274 (= D317), A293 (≠ E335), H301 (= H343), L302 (≠ S344), Y303 (≠ N345), E321 (vs. gap)
- binding magnesium ion: D199 (= D239), E225 (= E264), R240 (= R283), L243 (vs. gap), E251 (≠ T292)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
25% identity, 65% coverage: 113:406/449 of query aligns to 103:357/373 of 3cb3A
- active site: T143 (≠ F157), K171 (= K209), K173 (= K211), D202 (= D239), N204 (= N241), E228 (= E264), G253 (≠ N293), E254 (≠ M294), M275 (≠ L315), D277 (= D317), H304 (= H343), F305 (≠ I350), A306 (≠ S351), E324 (≠ I369)
- binding l-glucaric acid: K171 (= K209), K173 (= K211), D202 (= D239), E254 (≠ M294), H304 (= H343)
- binding magnesium ion: D202 (= D239), E228 (= E264), A243 (≠ M279), F246 (= F282), E254 (≠ M294)
Sites not aligning to the query:
Query Sequence
>AO353_29040 FitnessBrowser__pseudo3_N2E3:AO353_29040
MNTEHLHHTGKAPLITSLQVIPVAGHDSMLMNLSGAHGPFFTRNIVILKDSAGNVGVGEV
PGGERIRETLEDARSLVVGQPIGNYQSILNAMRSAFAARDSAGRGQQTFDLRITIHAVTA
MEAALLDLLGQFLEVPVAALLGEGQQRDAVKMLGYLFYIGDRHQTDLAYRSEPDADDWFR
LRHEQAMTPEAVVRLAEAAKAKYGFNDFKLKGGVLRGEEEIEAVTALAERFPDARITLDP
NGAWSLKEAIRLCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRATGLKTATNMIATDWR
EMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCHEWGLTWGSHSNNHFDISLAMFTQVAA
AAPGDITAIDTHWIWQDGQRLTQEPLQIVDGYIKVPARPGLGVDIDMDAVAKAHELYKGM
GLGARDDSVAMQFMIPGWKFDNKKPCLVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory