Comparing AO353_29125 FitnessBrowser__pseudo3_N2E3:AO353_29125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
34% identity, 95% coverage: 20:382/382 of query aligns to 27:378/380 of 7rsfA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
30% identity, 86% coverage: 52:381/382 of query aligns to 50:374/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
30% identity, 86% coverage: 52:381/382 of query aligns to 54:378/380 of 5vo3A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
29% identity, 67% coverage: 2:258/382 of query aligns to 3:258/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
29% identity, 67% coverage: 2:258/382 of query aligns to 3:258/376 of 4o23A
7lgpB Dape enzyme from shigella flexneri
27% identity, 87% coverage: 52:382/382 of query aligns to 52:376/377 of 7lgpB
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
28% identity, 75% coverage: 52:339/382 of query aligns to 50:332/377 of 7t1qA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 89% coverage: 28:366/382 of query aligns to 33:366/383 of 7uoiA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
27% identity, 83% coverage: 65:382/382 of query aligns to 99:421/426 of 3pfoA
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
25% identity, 99% coverage: 1:379/382 of query aligns to 6:358/360 of 2f7vA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
25% identity, 99% coverage: 1:379/382 of query aligns to 5:363/366 of Q8P8J5
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
30% identity, 60% coverage: 52:282/382 of query aligns to 4:222/392 of 7m6uB
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
39% identity, 30% coverage: 52:167/382 of query aligns to 52:170/258 of 4h2kA
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
30% identity, 60% coverage: 52:282/382 of query aligns to 69:287/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
30% identity, 60% coverage: 52:282/382 of query aligns to 94:312/415 of P06621
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
24% identity, 91% coverage: 4:349/382 of query aligns to 12:363/407 of P37111
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
31% identity, 36% coverage: 27:164/382 of query aligns to 27:165/265 of 4op4B
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
31% identity, 37% coverage: 51:193/382 of query aligns to 105:263/503 of Q8C165
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
23% identity, 80% coverage: 61:364/382 of query aligns to 82:440/458 of 2pokA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 56% coverage: 64:277/382 of query aligns to 74:295/408 of Q03154
Sites not aligning to the query:
>AO353_29125 FitnessBrowser__pseudo3_N2E3:AO353_29125
MSNSVDLLKQLVAFDTTSRESNLHLIDFVRDYLERFDVPCERVYNEQRSKANLFATIGPA
DRPGIVLSGHTDVVPVDGQPWTVAPFQLSERDGKLYGRGTADMKGYIACVLALVPSLVNA
PLRRPVHIALSYDEEVGCLGVRSLLKALEQRPVKPMLCIIGEPTELKPVLGHKGKLAMRC
DIHGEACHSAYAPLGVNAIEYAAELIGELGRIGHRLKVPEHHDARFDPPFSTVQTGMISG
GKALNIVPADCRFDFEIRALPSQDPSVVAKELKTYAEQQVLPRMRAVSDQSDIRFSELSA
YPGLATDAHSEAAELIAAFSGSREFGTVAFGTEGGLFDAAGIPTVVCGPGSMDQGHKPDE
FVSLDQLKGCDAMLQRMLSSIC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory