Comparing AO356_00035 FitnessBrowser__pseudo5_N2C3_1:AO356_00035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
32% identity, 94% coverage: 6:292/304 of query aligns to 8:312/312 of 4wjmA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 98% coverage: 6:304/304 of query aligns to 4:309/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
30% identity, 96% coverage: 6:296/304 of query aligns to 4:301/301 of 1v1aA
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
30% identity, 95% coverage: 6:295/304 of query aligns to 4:300/300 of 1v1bA
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
30% identity, 97% coverage: 6:299/304 of query aligns to 3:299/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
30% identity, 96% coverage: 6:297/304 of query aligns to 3:297/297 of 1tz6A
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
27% identity, 92% coverage: 3:283/304 of query aligns to 1:290/308 of 3iq0B
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 99% coverage: 3:303/304 of query aligns to 4:314/319 of Q8ZKR2
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
25% identity, 93% coverage: 9:291/304 of query aligns to 5:290/302 of 3gbuA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
25% identity, 93% coverage: 9:291/304 of query aligns to 6:291/304 of 3ih0A
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
26% identity, 90% coverage: 10:284/304 of query aligns to 8:291/306 of 5eynA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
28% identity, 81% coverage: 10:254/304 of query aligns to 12:260/310 of 5yggA
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
30% identity, 91% coverage: 7:284/304 of query aligns to 5:282/282 of 7fcaD
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
27% identity, 97% coverage: 5:299/304 of query aligns to 4:320/322 of 3lkiB
2afbA Crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution (see paper)
26% identity, 88% coverage: 29:297/304 of query aligns to 37:328/329 of 2afbA
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
23% identity, 96% coverage: 6:297/304 of query aligns to 3:308/311 of 2varA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
23% identity, 96% coverage: 6:297/304 of query aligns to 4:309/313 of Q97U29
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 96% coverage: 4:296/304 of query aligns to 69:375/379 of A1A6H3
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
26% identity, 96% coverage: 4:296/304 of query aligns to 3:309/313 of 6ilsB
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
24% identity, 96% coverage: 6:296/304 of query aligns to 4:308/312 of 3in1A
>AO356_00035 FitnessBrowser__pseudo5_N2C3_1:AO356_00035
MQLPSVVVFGEALTDVVQHSPGRWQGYPGGAPWNVARAMSRLGVPTAFAGSISTDSLGDE
LAQQSKAAGLDMRFLQRVDADPLVAIVPSSHPPRYFFAGEADLLFDVDQLPAGWLDAVRL
CHFSCISLARQPLGDRLVEVARRVKEEDKLISYDPNWRNLMDTRYRELTFPAMVELADII
KLSDEDLRQIYPGLNEEQALHTLRTMNASAQILFTRGAKGMALYAADVKFEQPAIAVEVA
DTVGAGDSSMAGWLASTLLGIQEPHARLEFSAACASVSCSHAGAYAPSREEVEDLLSNRM
QHQR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory