SitesBLAST
Comparing AO356_00820 FitnessBrowser__pseudo5_N2C3_1:AO356_00820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
38% identity, 84% coverage: 1:290/346 of query aligns to 1:284/339 of 1rjwA
- active site: C38 (= C38), H39 (≠ R39), T40 (≠ S40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), K110 (≠ F108), C148 (= C148), T152 (= T152)
- binding trifluoroethanol: T40 (≠ S40), C148 (= C148)
- binding zinc ion: C38 (= C38), H61 (= H60), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104)
Sites not aligning to the query:
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
38% identity, 84% coverage: 1:290/346 of query aligns to 1:284/337 of 3piiA
- active site: C38 (= C38), H39 (≠ R39), T40 (≠ S40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), K110 (≠ F108), C148 (= C148), T152 (= T152)
- binding butyramide: T40 (≠ S40), H61 (= H60), W87 (≠ F86), C148 (= C148)
- binding zinc ion: C38 (= C38), H61 (= H60), E62 (= E61), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), C148 (= C148)
Sites not aligning to the query:
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
41% identity, 84% coverage: 1:290/346 of query aligns to 6:289/341 of 1lluA
- active site: C43 (= C38), H44 (≠ R39), T45 (≠ S40), H48 (= H43), H66 (= H60), E67 (= E61), C97 (= C90), C100 (= C93), C103 (= C96), C111 (= C104), Q115 (≠ F108), C153 (= C148), T157 (= T152)
- binding 1,2-ethanediol: H44 (≠ R39), T45 (≠ S40), L47 (≠ W42), D53 (≠ H48), W92 (≠ F86), C153 (= C148)
- binding nicotinamide-adenine-dinucleotide: C43 (= C38), H44 (≠ R39), T45 (≠ S40), H48 (= H43), C153 (= C148), T157 (= T152), G179 (= G175), G180 (= G176), L181 (≠ V177), D200 (= D196), I201 (= I197), K205 (= K201), A243 (≠ L241), V244 (≠ G242), S245 (≠ H243), A248 (≠ T246), V265 (= V263), L267 (= L265)
- binding zinc ion: C43 (= C38), H66 (= H60), C100 (= C93), C103 (= C96), C111 (= C104), C153 (= C148)
Sites not aligning to the query:
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
36% identity, 84% coverage: 1:290/346 of query aligns to 1:284/337 of P12311
- C38 (= C38) mutation to S: No activity.
- T40 (≠ S40) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (= H43) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
33% identity, 99% coverage: 1:343/346 of query aligns to 1:334/336 of 6iqdA
- active site: C38 (= C38), T40 (≠ S40), H43 (= H43), H61 (= H60), C148 (= C148)
- binding zinc ion: C38 (= C38), H61 (= H60), E62 (= E61), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), C148 (= C148)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
34% identity, 95% coverage: 1:327/346 of query aligns to 3:301/341 of 3meqA
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), L112 (≠ F108), C150 (= C148), T154 (= T152)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), C150 (= C148), T154 (= T152), G176 (= G175), G177 (= G176), L178 (≠ V177), D197 (= D196), I198 (= I197), K202 (= K201), T241 (≠ A240), A242 (≠ L241), V243 (≠ G242), S244 (≠ H243), A247 (≠ T246), N264 (≠ V263), G265 (= G264), L266 (= L265), I289 (≠ L315), V290 (= V316)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), C150 (= C148)
Sites not aligning to the query:
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
33% identity, 99% coverage: 1:343/346 of query aligns to 8:340/344 of 6n7lC
- active site: C45 (= C38), T47 (≠ S40), H50 (= H43), H68 (= H60), C154 (= C148)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), H46 (≠ R39), T47 (≠ S40), H50 (= H43), C154 (= C148), T158 (= T152), G178 (= G173), G180 (= G175), G181 (= G176), L182 (≠ V177), D201 (= D196), V202 (≠ I197), K206 (= K201), T243 (≠ A240), A244 (≠ L241), V245 (≠ G242), S246 (≠ H243), A249 (≠ T246), N266 (≠ V263), G267 (= G264), L268 (= L265), I291 (≠ R297), V292 (≠ Y298)
- binding zinc ion: C45 (= C38), H68 (= H60), C98 (= C90), C101 (= C93), C104 (= C96), C112 (= C104), C154 (= C148)
3s2fE Crystal structure of furx nadh:furfural
39% identity, 79% coverage: 1:273/346 of query aligns to 3:272/340 of 3s2fE
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), Q112 (≠ F108), C150 (= C148), T154 (= T152)
- binding furfural: T42 (≠ S40), W51 (≠ D49), H63 (= H60), W89 (≠ F86), C150 (= C148)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (≠ R39), T42 (≠ S40), C150 (= C148), T154 (= T152), G174 (= G173), G176 (= G175), G177 (= G176), L178 (≠ V177), D197 (= D196), I198 (= I197), K202 (= K201), T239 (≠ A240), A240 (≠ L241), V241 (≠ G242), N262 (≠ V263), G263 (= G264), L264 (= L265)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), C150 (= C148)
Sites not aligning to the query:
3s2fA Crystal structure of furx nadh:furfural
39% identity, 79% coverage: 1:273/346 of query aligns to 3:272/340 of 3s2fA
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), Q112 (≠ F108), C150 (= C148), T154 (= T152)
- binding phosphorylisopropane: T42 (≠ S40), H63 (= H60), W89 (≠ F86)
- binding zinc ion: C40 (= C38), H63 (= H60), E64 (= E61), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), C150 (= C148)
Sites not aligning to the query:
3s2eE Crystal structure of furx nadh complex 1
39% identity, 79% coverage: 1:273/346 of query aligns to 3:272/340 of 3s2eE
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), Q112 (≠ F108), C150 (= C148), T154 (= T152)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (≠ R39), T42 (≠ S40), C150 (= C148), T154 (= T152), G176 (= G175), G177 (= G176), L178 (≠ V177), D197 (= D196), I198 (= I197), K202 (= K201), T239 (≠ A240), A240 (≠ L241), V241 (≠ G242), S242 (≠ H243), A245 (≠ T246), N262 (≠ V263), G263 (= G264), L264 (= L265)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), C150 (= C148)
Sites not aligning to the query:
3s2eA Crystal structure of furx nadh complex 1
39% identity, 79% coverage: 1:273/346 of query aligns to 3:272/340 of 3s2eA
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), Q112 (≠ F108), C150 (= C148), T154 (= T152)
- binding zinc ion: C40 (= C38), H63 (= H60), E64 (= E61), C94 (= C90), C97 (= C93), C100 (= C96), C108 (= C104), C150 (= C148)
Sites not aligning to the query:
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
38% identity, 78% coverage: 1:269/346 of query aligns to 1:266/338 of Q8GIX7
- C38 (= C38) binding
- H61 (= H60) binding
- E62 (= E61) binding
- C92 (= C90) binding
- C95 (= C93) binding
- C98 (= C96) binding
- C106 (= C104) binding
- C148 (= C148) binding
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
38% identity, 78% coverage: 1:269/346 of query aligns to 1:266/345 of 4z6kA
- active site: C38 (= C38), H39 (≠ R39), T40 (≠ S40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), Q110 (≠ F108), C148 (= C148), T152 (= T152)
- binding zinc ion: C38 (= C38), H61 (= H60), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), C148 (= C148)
Sites not aligning to the query:
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
35% identity, 80% coverage: 1:277/346 of query aligns to 4:274/336 of 6z42A
- active site: C41 (= C38), T43 (≠ S40), H46 (= H43), H64 (= H60), C148 (= C148)
- binding zinc ion: C41 (= C38), H64 (= H60), E65 (= E61), C95 (= C90), C98 (= C93), C101 (= C96), C109 (= C104), C148 (= C148)
5yatA Crystal structure of mitochondrial alcohol dehydrogenase isozyme iii from komagataella phaffii gs115 (see paper)
33% identity, 91% coverage: 2:317/346 of query aligns to 7:321/347 of 5yatA
- active site: C43 (= C38), T45 (≠ S40), H48 (= H43), H66 (= H60), C153 (= C148)
- binding zinc ion: C43 (= C38), H66 (= H60), E67 (= E61), C97 (= C90), C100 (= C93), C103 (= C96), C111 (= C104), C153 (= C148)
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
31% identity, 99% coverage: 1:343/346 of query aligns to 1:345/347 of 2eerB
- active site: C38 (= C38), H39 (≠ R39), S40 (= S40), H43 (= H43), H68 (= H60), E69 (= E61), E98 (≠ C90), C101 (= C93), C104 (= C96), C112 (= C104), R116 (≠ F108), C154 (= C148), T158 (= T152), R342 (≠ V340)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (≠ R39), S40 (= S40), H43 (= H43), C154 (= C148), T158 (= T152), G178 (≠ H172), G181 (= G175), G182 (= G176), L183 (≠ V177), D203 (= D196), V204 (≠ I197), R205 (≠ C198), L247 (≠ A240), N248 (≠ L241), V270 (= V263), G271 (= G264), L272 (= L265), F273 (≠ M266), L295 (≠ H291), V296 (≠ G292), R342 (≠ V340)
- binding zinc ion: E98 (≠ C90), C101 (= C93), C104 (= C96), C112 (= C104)
P00330 Alcohol dehydrogenase 1; Alcohol dehydrogenase I; ADHI; NADH-dependent methylglyoxal reductase; YADH-1; EC 1.1.1.1; EC 1.1.1.54; EC 1.1.1.78 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 6 papers)
35% identity, 71% coverage: 21:265/346 of query aligns to 27:271/348 of P00330
- C44 (= C38) binding
- H45 (≠ R39) binding ; mutation to R: Decreases dissociation constants by 4-fold for NAD(+) and 2-fold for NADH, while turnover numbers were decreased by 4-fold for ethanol oxidation and 6-fold for acetaldehyde reduction.
- T46 (≠ S40) binding ; mutation to S: Has the same pattern of activity as the wild-type enzyme for linear primary alcohols.
- H49 (= H43) binding
- W55 (≠ D49) mutation to M: Has lowered reactivity with primary and secondary alcohols.
- H67 (= H60) binding
- E68 (= E61) binding in the open conformation
- W93 (≠ F86) mutation to A: Has an inverted specificity pattern for primary alcohols, being 3- and 10-fold more active on hexanol and 350- and 540-fold less active on ethanol. Also acquires weak activity on branched chain alcohols and cyclohexanol.
- C98 (= C90) binding
- C101 (= C93) binding
- C104 (= C96) binding
- C112 (= C104) binding
- C154 (= C148) binding
- G181 (= G175) binding
- G182 (= G176) binding
- L183 (≠ V177) binding
- D202 (= D196) binding
- K207 (= K201) binding
- F222 (≠ A216) binding
- T236 (= T230) natural variant: T -> I
- V269 (= V263) binding
- M271 (≠ L265) binding ; mutation to L: Produces a 7 to 10-fold increase in reactivity with butanol, pentanol, and hexanol.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
- 294 binding
- 296 binding
- 341 binding
5envA Yeast alcohol dehydrogenase with bound coenzyme (see paper)
35% identity, 71% coverage: 21:265/346 of query aligns to 26:270/347 of 5envA
- active site: C43 (= C38), H44 (≠ R39), T45 (≠ S40), H48 (= H43), H66 (= H60), E67 (= E61), C97 (= C90), C100 (= C93), C103 (= C96), C111 (= C104), D115 (≠ F108), C153 (= C148)
- binding trifluoroethanol: T45 (≠ S40), W54 (≠ D49), H66 (= H60), W92 (≠ F86), C153 (= C148), M270 (≠ L265)
- binding nicotinamide-adenine-dinucleotide: H44 (≠ R39), T45 (≠ S40), H48 (= H43), T157 (= T152), G177 (= G173), G180 (= G175), G181 (= G176), L182 (≠ V177), D201 (= D196), K206 (= K201), F221 (≠ A216), S246 (≠ L241), V268 (= V263), G269 (= G264)
- binding zinc ion: C43 (= C38), H66 (= H60), C97 (= C90), C100 (= C93), C103 (= C96), C111 (= C104), C153 (= C148)
Sites not aligning to the query:
4w6zA Yeast alcohol dehydrogenase i, saccharomyces cerevisiae fermentative enzyme (see paper)
35% identity, 71% coverage: 21:265/346 of query aligns to 26:270/347 of 4w6zA
- active site: C43 (= C38), H44 (≠ R39), T45 (≠ S40), H48 (= H43), H66 (= H60), E67 (= E61), C97 (= C90), C100 (= C93), C103 (= C96), C111 (= C104), D115 (≠ F108), C153 (= C148)
- binding nicotinamide-8-iodo-adenine-dinucleotide: C43 (= C38), H44 (≠ R39), T45 (≠ S40), H48 (= H43), W54 (≠ D49), C153 (= C148), T157 (= T152), G177 (= G173), G180 (= G175), G181 (= G176), L182 (≠ V177), I200 (= I195), D201 (= D196), K206 (= K201), F221 (≠ A216), S246 (≠ L241), S248 (≠ H243), A251 (≠ T246), V268 (= V263), G269 (= G264), M270 (≠ L265)
- binding trifluoroethanol: T45 (≠ S40), W54 (≠ D49), H66 (= H60), W92 (≠ F86), C153 (= C148)
- binding zinc ion: C43 (= C38), H66 (= H60), C97 (= C90), C100 (= C93), C103 (= C96), C111 (= C104), C153 (= C148)
Sites not aligning to the query:
P00331 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADHII; YADH-2; EC 1.1.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 76% coverage: 2:265/346 of query aligns to 8:271/348 of P00331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
Query Sequence
>AO356_00820 FitnessBrowser__pseudo5_N2C3_1:AO356_00820
MKAVVYEAFSQPPRLMTVEDPTPERHGVVVQVLGTGVCRSDWHGWKGHDPDIQLPHVPGH
ELAGIVAEVGRDVTRWKVGDRITVPFVGGCGACPECNSGNQQVCHSQFQPGFTHWGSFAE
YVGIHKADLNLVALPENMDFATAASLGCRFVTSFRAVVDQGKVTAGQWVAVHGCGGVGLS
AVMIAHAIGANVIAIDICDDKLKLAQSLGAVATINASRVADVTEAVLEITKGGAHVSLDA
LGHPTTCFNSINNLRRRGRHVQVGLMLADHSTPSIPMSKVIAYELEICGSHGMQAHRYGA
MMEMITSGKLAPEKLVGKTISLEQSIDALMNMDRFDTAGVTVVTQF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory