SitesBLAST
Comparing AO356_01090 FitnessBrowser__pseudo5_N2C3_1:AO356_01090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 86% coverage: 44:470/499 of query aligns to 33:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ A84), G75 (= G86), S76 (≠ A87), G77 (= G88), T78 (= T89), G79 (= G90), L80 (= L91), A83 (≠ G94), C84 (≠ A95), P137 (= P148), G138 (≠ S149), E139 (≠ S150), A142 (= A153), T143 (≠ S155), G146 (= G158), N147 (= N159), S149 (≠ A161), T150 (≠ E162), A152 (= A164), G153 (= G165), E203 (= E214), G204 (= G215), I209 (= I220), E422 (= E430), H423 (= H431)
- binding fe (iii) ion: H377 (= H386), H384 (= H393), E422 (= E430)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 88% coverage: 29:469/499 of query aligns to 23:453/459 of P9WIT1
- K354 (≠ E365) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
30% identity, 90% coverage: 21:470/499 of query aligns to 6:463/465 of 3pm9A
- active site: A149 (= A164), L159 (= L174)
- binding flavin-adenine dinucleotide: P69 (≠ A84), Q70 (≠ R85), G71 (= G86), G72 (≠ A87), N73 (≠ G88), T74 (= T89), G75 (= G90), L76 (= L91), G79 (= G94), Q80 (≠ A95), L91 (≠ M106), L133 (≠ P148), G134 (≠ S149), A135 (≠ S150), C139 (= C154), T140 (≠ S155), G142 (= G157), G143 (= G158), S146 (≠ A161), T147 (≠ E162), A149 (= A164), G150 (= G165), E200 (= E214), G201 (= G215), I205 (≠ V219), I206 (= I220), E423 (= E430)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), W322 (≠ F341), E413 (= E430), H414 (= H431), N450 (= N467)
- binding lactic acid: R318 (= R337), H369 (= H386), H376 (= H393), H414 (= H431)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E430)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
29% identity, 93% coverage: 12:474/499 of query aligns to 6:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ G48), P76 (≠ A84), G78 (= G86), G79 (≠ A87), N80 (≠ G88), T81 (= T89), G82 (= G90), M83 (≠ L91), G86 (= G94), S87 (≠ A95), L140 (≠ P148), A142 (≠ S150), C146 (= C154), H147 (≠ S155), G150 (= G158), N151 (= N159), A153 (= A161), T154 (≠ E162), G208 (= G215), I212 (≠ V219), I213 (= I220), E423 (= E430), N460 (= N467)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
29% identity, 93% coverage: 12:474/499 of query aligns to 5:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R337), T337 (≠ F341), K348 (≠ C353), Y379 (≠ V384), H381 (= H386), H388 (= H393), H423 (= H431)
- binding flavin-adenine dinucleotide: W39 (≠ G48), P75 (≠ A84), Q76 (≠ R85), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (= G90), M82 (≠ L91), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), G149 (= G158), N150 (= N159), A152 (= A161), T153 (≠ E162), G157 (= G166), G207 (= G215), I212 (= I220), E422 (= E430), N459 (= N467)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E430)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
29% identity, 93% coverage: 12:474/499 of query aligns to 5:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ G48), P75 (≠ A84), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (= G90), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), H146 (≠ S155), G148 (= G157), G149 (= G158), N150 (= N159), A152 (= A161), T153 (≠ E162), A155 (= A164), E206 (= E214), G207 (= G215), I211 (≠ V219), I212 (= I220), E422 (= E430), N459 (= N467)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R337), T337 (≠ F341), K348 (≠ C353), Y379 (≠ V384), H381 (= H386), H388 (= H393), H423 (= H431)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E430)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
29% identity, 93% coverage: 12:474/499 of query aligns to 5:466/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (≠ G48), P75 (≠ A84), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (= G90), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), H146 (≠ S155), G149 (= G158), N150 (= N159), A152 (= A161), T153 (≠ E162), A155 (= A164), G157 (= G166), E206 (= E214), G207 (= G215), I211 (≠ V219), I212 (= I220), E422 (= E430), N459 (= N467)
- binding d-malate: M82 (≠ L91), R333 (= R337), T337 (≠ F341), K348 (≠ C353), Y379 (≠ V384), H381 (= H386), H388 (= H393), E422 (= E430), H423 (= H431)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E430)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
29% identity, 93% coverage: 12:474/499 of query aligns to 5:466/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R337), T337 (≠ F341), K348 (≠ C353), Y379 (≠ V384), H381 (= H386), H388 (= H393), N390 (≠ L395), H423 (= H431)
- binding flavin-adenine dinucleotide: W39 (≠ G48), P75 (≠ A84), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (= G90), M82 (≠ L91), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), G149 (= G158), N150 (= N159), A152 (= A161), T153 (≠ E162), A155 (= A164), G157 (= G166), G207 (= G215), I212 (= I220), E422 (= E430), H423 (= H431)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E430)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), W323 (≠ F341), E414 (= E430), H415 (= H431), N451 (= N467)
- binding manganese (ii) ion: H370 (= H386), H377 (= H393), E414 (= E430)
- binding pyruvic acid: R319 (= R337), H370 (= H386), H377 (= H393), H415 (= H431)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R337), H369 (= H386), H376 (= H393), H414 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), W322 (≠ F341), E413 (= E430), H414 (= H431), N450 (= N467)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E430)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
29% identity, 93% coverage: 12:474/499 of query aligns to 58:519/521 of Q8N465
- S109 (≠ V65) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V83) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A87) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L103) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F109) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V128) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A145) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A161) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ V187) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G189) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D326) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R337) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F341) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ Y351) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ C353) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ A371) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G378) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H386) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G388) to V: slight reduction in catalytic activity
- N439 (= N391) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H393) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L395) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I396) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ F398) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E430) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H431) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G432) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R337), W322 (≠ F341), H369 (= H386), H376 (= H393), H414 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), W322 (≠ F341), E413 (= E430), N450 (= N467)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E430)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:452/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L91), R317 (= R337), W321 (≠ F341), H368 (= H386), H375 (= H393), H413 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), W321 (≠ F341), Y322 (≠ P342), E412 (= E430), H413 (= H431), N449 (= N467)
- binding manganese (ii) ion: H368 (= H386), H375 (= H393), E412 (= E430)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:453/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), H369 (= H386), E413 (= E430), N450 (= N467)
- binding deaminohydroxyvaline: R319 (= R337), H414 (= H431)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), Y324 (≠ P342), H370 (= H386), E414 (= E430), N451 (= N467)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H431)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R337), W323 (≠ F341), H370 (= H386), H415 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), H370 (= H386), E414 (= E430), N451 (= N467)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H431)
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), Y324 (≠ P342), H370 (= H386), E414 (= E430), N451 (= N467)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), H370 (= H386), E414 (= E430), N451 (= N467)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H431)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
30% identity, 83% coverage: 56:470/499 of query aligns to 40:454/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ A84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (= G90), G78 (= G94), V79 (≠ A95), L90 (≠ M106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (= A161), T144 (≠ E162), A146 (= A164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (= I220), H370 (= H386), E414 (= E430), N451 (= N467)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R337), H415 (= H431)
Query Sequence
>AO356_01090 FitnessBrowser__pseudo5_N2C3_1:AO356_01090
MNILYDEHLDGPLPKVDKQTLLQAFQAQIPDLDILHQEQDLKPYECDGLSAYRTTPLLVV
LPRRVEQVQALLKLCHEQNVPVVARGAGTGLSGGALPLASGVLLVMARFNQILHIDPDAR
TARLQPGVRNLAISQAAAPFGLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLL
KLEILTVEGERLTLGSESLDSPGLDLLALFTGSEGLLGVITEVTVKLLPRPQVAKVLLAS
FDSVDKAGRAVADIIAAGIIPGGLEMMDNLAIRAAEDFIHAGYPVDAEAILLCELDGVEA
DVHDDCERVRQVLEQAGATEVRQARDEAERLRFWAGRKNAFPAVGRLAPDYYCMDGTIPR
RALPEVLQRIASLGAEYGLRVANVFHAGDGNMHPLILFDANQPGELERAETLGGKILELC
VQVGGSITGEHGVGREKINQMCTQFNSDELNLFHAVKAAFDPQGLLNPGKNIPTLQRCAE
FGAMHIHGGQLPFPELERF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory