Comparing AO356_01815 FitnessBrowser__pseudo5_N2C3_1:AO356_01815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
27% identity, 97% coverage: 10:405/410 of query aligns to 5:421/425 of O59010
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
27% identity, 92% coverage: 20:396/410 of query aligns to 7:402/408 of 6bauA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
27% identity, 92% coverage: 20:396/410 of query aligns to 7:402/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 92% coverage: 20:396/410 of query aligns to 6:401/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
26% identity, 94% coverage: 10:396/410 of query aligns to 2:407/413 of 6x14A
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
26% identity, 94% coverage: 10:396/410 of query aligns to 5:410/419 of 6x15A
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 73% coverage: 20:318/410 of query aligns to 7:322/396 of 6bmiA
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
26% identity, 97% coverage: 9:404/410 of query aligns to 2:418/427 of 5e9sA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
26% identity, 97% coverage: 9:404/410 of query aligns to 2:418/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
26% identity, 94% coverage: 20:404/410 of query aligns to 6:407/416 of 6r7rA
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
26% identity, 96% coverage: 10:404/410 of query aligns to 1:416/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
27% identity, 94% coverage: 20:404/410 of query aligns to 10:415/424 of 6zl4A
Sites not aligning to the query:
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
25% identity, 93% coverage: 12:393/410 of query aligns to 17:393/412 of 7awmA
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
25% identity, 93% coverage: 12:393/410 of query aligns to 9:379/397 of 5mjuA
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
28% identity, 60% coverage: 145:391/410 of query aligns to 237:485/573 of P31596
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
28% identity, 60% coverage: 145:391/410 of query aligns to 237:485/572 of P43006
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
25% identity, 93% coverage: 10:391/410 of query aligns to 3:404/425 of 7xr4A
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
26% identity, 59% coverage: 139:379/410 of query aligns to 233:479/543 of P56564
Sites not aligning to the query:
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
28% identity, 64% coverage: 147:409/410 of query aligns to 204:473/503 of Q10901
Sites not aligning to the query:
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
26% identity, 59% coverage: 139:379/410 of query aligns to 233:479/542 of P43003
Sites not aligning to the query:
>AO356_01815 FitnessBrowser__pseudo5_N2C3_1:AO356_01815
MTASSVTPLQRLKRTSLVTQIIIGLIAGIVLAWLAPDLAKSTAFIGKVFVSALKAVAPIL
VFVLVMASIANHKHGQETHIRPILFLYLLGTFAAAVVAVVASTLFPSSLVLSTQDVAVTA
PGGISEVLQSLLLSVVDNPVRALMDGNFIGILAWAIGMGIAIRHAGQTTRTVLEDLSNGV
TVIVRLVIRFAPLGIFGLVASTLATSGFGALLGYLQLLTVLIGCMLFVALVVNPLIVFWK
LRRNPYPLVFTCLRESGITAFFTRSSAANIPVNLELSKRLGLHEDTYSVSIPLGATINMA
GAAITITVLTLAAVHTLGIVVDVPTAVLLSVVAAICACGASGVAGGSLLLIPLACSLFGI
PSEIAMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACLGEEEKLARTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory